Clone Name | bastl50a08 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 67.0 bits (162), Expect = 2e-11 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 264 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG L Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKL 106
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 67.0 bits (162), Expect = 2e-11 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 264 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG L Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKL 106
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 58.5 bits (140), Expect = 8e-09 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 267 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 LEL V QD P + +L +++ IR++TSSMT+VPKPLKFLRPHY TL Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRPHYFTL 107
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 56.2 bits (134), Expect = 4e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 291 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 Q+ D + + ALE+M+ I+++TSSMT+VPKPLKFLRPHY T+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRPHYETM 90
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +3 Query: 267 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLKFLRP Y L Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDL 98
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 46.2 bits (108), Expect = 4e-05 Identities = 23/51 (45%), Positives = 33/51 (64%) Frame = +3 Query: 267 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 419 LE+ V + D + L +++ I+++TSSMT+VPKPLKFLRP Y L Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDL 99
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 8 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 106 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 29.6 bits (65), Expect = 4.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 8 PTQQRRVASVPLAPRTLASPPAPSPNRIRPA 100 P ++ +A VPLAP +PP+P+P R A Sbjct: 1129 PPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 8 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 103 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>YACF_SHIFL (Q83MF4) UPF0289 protein yacF| Length = 247 Score = 28.9 bits (63), Expect = 7.1 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +3 Query: 303 PGVQRLALESMRQEIRSATSSMTSVPKPLKFLR 401 PGV + +E++ Q++++A S + S P+ +FLR Sbjct: 81 PGVDQSRIEALIQQLKAAVSVLISAPRIGQFLR 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,621,035 Number of Sequences: 219361 Number of extensions: 521239 Number of successful extensions: 2860 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2849 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)