Clone Name | bastl50a01 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 77.0 bits (188), Expect = 2e-14 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = +2 Query: 257 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMP 436 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK YE+M Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMA 114 Query: 437 ESELK 451 E K Sbjct: 115 PGENK 119
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 77.0 bits (188), Expect = 2e-14 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = +2 Query: 257 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMP 436 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK YE+M Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMA 114 Query: 437 ESELK 451 E K Sbjct: 115 PGENK 119
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 67.8 bits (164), Expect = 1e-11 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = +2 Query: 260 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMPE 439 LEL V QD P + +L +++ IR++TSSMT+VPKPLKFLRPHY TL Y+S P+ Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRPHYFTLVKIYDSWPQ 116 Query: 440 SELKS 454 S K+ Sbjct: 117 SPQKT 121
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 63.5 bits (153), Expect = 3e-10 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = +2 Query: 284 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMPESELKST 457 Q+ D + + ALE+M+ I+++TSSMT+VPKPLKFLRPHY T+ Y+ P + KS+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRPHYETMTKLYDEWPAGDDKSS 105
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 60.5 bits (145), Expect = 2e-09 Identities = 29/66 (43%), Positives = 45/66 (68%) Frame = +2 Query: 260 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMPE 439 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLKFLRP Y L + Y+ + Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTD 107 Query: 440 SELKST 457 LKS+ Sbjct: 108 PNLKSS 113
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 51.2 bits (121), Expect = 1e-06 Identities = 26/66 (39%), Positives = 40/66 (60%) Frame = +2 Query: 260 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMPE 439 LE+ V + D + L +++ I+++TSSMT+VPKPLKFLRP Y L Y+ + Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDLCKAYDKWSD 108 Query: 440 SELKST 457 + KS+ Sbjct: 109 KDQKSS 114
>DMF1_SCHPO (P78953) Division mal foutue 1 protein| Length = 920 Score = 31.6 bits (70), Expect = 1.1 Identities = 19/69 (27%), Positives = 33/69 (47%) Frame = +2 Query: 263 ELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESMPES 442 ELY+ +++ +P + + +S++QE S TS+PK + YG Y +P Sbjct: 357 ELYLQSSRNSEPEISTIINDSLQQENMDEDISATSIPKS----QAAYGHGSVTYHEVPRY 412 Query: 443 ELKSTWLTY 469 L S + Y Sbjct: 413 NLTSASVGY 421
>UACA_MOUSE (Q8CGB3) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein (Nucling) (Nuclear membrane-binding protein) Length = 1411 Score = 30.0 bits (66), Expect = 3.2 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 257 QLELYVVRAQDVDPGVQ-RLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKTYYESM 433 Q ++Y Q PG+ + SM + + + S TS + + L+ TL+TYY+S Sbjct: 403 QGQMYTTEPQCASPGIPPHMHSRSMLRPLELSLPSQTSYSEN-EILKKELETLRTYYDSA 461 Query: 434 PESELK 451 + LK Sbjct: 462 KQDRLK 467
>YACF_SHIFL (Q83MF4) UPF0289 protein yacF| Length = 247 Score = 28.9 bits (63), Expect = 7.2 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +2 Query: 296 PGVQRLALESMRQEIRSATSSMTSVPKPLKFLR 394 PGV + +E++ Q++++A S + S P+ +FLR Sbjct: 81 PGVDQSRIEALIQQLKAAVSVLISAPRIGQFLR 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,093,331 Number of Sequences: 219361 Number of extensions: 456473 Number of successful extensions: 1721 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)