Clone Name | bastl47h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RNAS9_PONPY (Q7YRH4) Ribonuclease-like protein 9 precursor | 28 | 8.1 | 2 | RNAS9_HUMAN (P60153) Ribonuclease-like protein 9 precursor | 28 | 8.1 | 3 | RNAS9_GORGO (Q863K0) Ribonuclease-like protein 9 precursor | 28 | 8.1 |
---|
>RNAS9_PONPY (Q7YRH4) Ribonuclease-like protein 9 precursor| Length = 204 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 218 RSIAFVHRMVARNYFILVNKIRLQRIVFLR 129 +++ + HR VA +YF+L+ LQ+I + R Sbjct: 89 KNVYYKHRCVAEHYFLLMQYDELQKICYNR 118
>RNAS9_HUMAN (P60153) Ribonuclease-like protein 9 precursor| Length = 205 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 218 RSIAFVHRMVARNYFILVNKIRLQRIVFLR 129 +++ + HR VA +YF+L+ LQ+I + R Sbjct: 90 KNVYYKHRWVAEHYFLLMQYDELQKICYNR 119
>RNAS9_GORGO (Q863K0) Ribonuclease-like protein 9 precursor| Length = 205 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 218 RSIAFVHRMVARNYFILVNKIRLQRIVFLR 129 +++ + HR VA +YF+L+ LQ+I + R Sbjct: 90 KNVYYKHRCVAEHYFLLMQYDELQKICYNR 119 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,942,022 Number of Sequences: 219361 Number of extensions: 436098 Number of successful extensions: 601 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)