Clone Name | bastl47g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleo... | 32 | 0.37 | 2 | DNLI_THEAC (Q9HJ26) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleo... | 28 | 7.0 |
---|
>DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 588 Score = 32.0 bits (71), Expect = 0.37 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -3 Query: 185 ERGCDTRTPDSRADAANWSTGGRVWSWGGLARVWTRWRWDT 63 E GC+ S AD + + G R W W L R + WDT Sbjct: 396 EDGCEGLVAKSMADDSYYKAGARGWLWIKLKRDYQAQLWDT 436
>DNLI_THEAC (Q9HJ26) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 588 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -3 Query: 185 ERGCDTRTPDSRADAANWSTGGRVWSWGGLARVWTRWRWDT 63 E GC+ S + + + G R W W L R + WDT Sbjct: 396 EDGCEGLVAKSTSPDSFYKAGARGWLWIKLKRDYQAQLWDT 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,353,636 Number of Sequences: 219361 Number of extensions: 330128 Number of successful extensions: 1104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)