Clone Name | bastl47f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLYA_ANAMM (Q5PBM8) Serine hydroxymethyltransferase (EC 2.1.2.1)... | 28 | 4.1 | 2 | ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat prot... | 27 | 9.1 | 3 | RIN2_HUMAN (Q8WYP3) Ras and Rab interactor 2 (Ras interaction/in... | 27 | 9.1 | 4 | PQQB_PSEFL (P55172) Coenzyme PQQ synthesis protein B (Pyrroloqui... | 27 | 9.1 |
---|
>GLYA_ANAMM (Q5PBM8) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine| methylase) (SHMT) Length = 430 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 126 LLANIANTETLALGSCFPRLPFLHTHICIS 37 LLA+IA+ L G C+P PF H H+ S Sbjct: 200 LLADIAHYSGLIAGGCYPS-PFGHAHVVTS 228
>ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat protein GP70;| Spike protein p15E] Length = 667 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 14/48 (29%) Frame = -2 Query: 105 TETLALGSCFPRLPFLHTHICIS------------LLPLQQRW--CST 4 TE G C ++PF H H+C LLP W CST Sbjct: 394 TEVSGHGLCIGKVPFTHQHLCNQTLSINSSGDHQYLLPSNHSWWACST 441
>RIN2_HUMAN (Q8WYP3) Ras and Rab interactor 2 (Ras interaction/interference| protein 2) (Ras inhibitor JC265) (Ras association domain family 4) Length = 895 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 239 SDSADEDP*GAPPLLRPIIDDGMCLAGI 156 S AD P PP RP+ DG+C A + Sbjct: 213 SSPADSKPPNLPPPHRPLSSDGVCPASL 240
>PQQB_PSEFL (P55172) Coenzyme PQQ synthesis protein B (Pyrroloquinoline quinone| biosynthesis protein B) Length = 303 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = -3 Query: 245 WPSDSADEDP*GAPPLLRPII--DDGMCLAGIVMVRTYSLPCC*PI*LTPKP*RSAPASR 72 W +D ED PL + + + G+ I + +++S+P C + TP P RSA Sbjct: 109 WCTDMVHEDLSTGFPLFKMLSHWNGGLSWNRIELDQSFSIPACPNLRFTPLPLRSAAPPY 168 Query: 71 AFHFF 57 + H F Sbjct: 169 SPHRF 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,952,790 Number of Sequences: 219361 Number of extensions: 458703 Number of successful extensions: 911 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)