Clone Name | bastl47c10 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 55.5 bits (132), Expect = 6e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 308 QLELYVVRAQDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 +LE+ V R + D + R ALE +R++IR +T+SMTSVPKPLKFLRP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRP 101
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 55.5 bits (132), Expect = 6e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 308 QLELYVVRAQDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 +LE+ V R + D + R ALE +R++IR +T+SMTSVPKPLKFLRP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRP 101
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +2 Query: 311 LELYVVRAQDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 LEL V QD P + +L +++ IR +TSSMT+VPKPLKFLRP Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRP 102
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 49.3 bits (116), Expect = 4e-06 Identities = 23/46 (50%), Positives = 34/46 (73%) Frame = +2 Query: 311 LELYVVRAQDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 LEL V R ++ D + +L ++++ I+ +TSSMT+VPKPLKFLRP Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRP 93
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 47.8 bits (112), Expect = 1e-05 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +2 Query: 335 QDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 Q+ D + + ALE+M+ I+ +TSSMT+VPKPLKFLRP Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRP 85
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 42.0 bits (97), Expect = 7e-04 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +2 Query: 311 LELYVVRAQDVDPGVQRLALESMRQEIRLATSSMTSVPKPLKFLRP 448 LE+ V + D + L +++ I+ +TSSMT+VPKPLKFLRP Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRP 94
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 9 AAKQSKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 116 AAK SK L+ + P A +R TTR P P++PAS Sbjct: 125 AAKTSK---LRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 9 AAKQSKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 116 AAK SK L+ + P A +R TTR P P++PAS Sbjct: 125 AAKTSK---LRGLKPKKAPTARKTTTRRPKPTRPAS 157
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 134 IRFGDGAGGLARVRGASGTEATRRCCVGVY 45 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>AGRN_HUMAN (O00468) Agrin precursor| Length = 2045 Score = 28.9 bits (63), Expect = 6.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 6 PAAKQSKAEILQKINPHAAAPSRLRTTRPPNPSQP 110 P AK + A ++ P APSR+ RPP P QP Sbjct: 1297 PVAKTTAAPTTRR--PPTTAPSRVPGRRPPAPQQP 1329
>ODO2_HUMAN (P36957) Dihydrolipoyllysine-residue succinyltransferase component| of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2) (E2 Length = 453 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +3 Query: 3 APAAKQSKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 116 APAA KAE P AAP + P+PSQP S Sbjct: 158 APAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPS 195
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 21 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 116 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.136 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,957,451 Number of Sequences: 219361 Number of extensions: 418985 Number of successful extensions: 2153 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2149 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)