Clone Name | bastl47a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OC17_CHICK (Q9PRS8) Ovocleidin-17 (OC-17) | 30 | 3.2 | 2 | FDHA_DESGI (Q934F5) Formate dehydrogenase alpha subunit precurso... | 28 | 9.4 |
---|
>OC17_CHICK (Q9PRS8) Ovocleidin-17 (OC-17)| Length = 142 Score = 30.0 bits (66), Expect = 3.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 230 GERGREWSSWLVSRAPLWLAGERARADGRCCRLSDSE*PYGW 105 G R WS R W +AR GRC L D E W Sbjct: 84 GSRSWRWSDGTAPRFASWHRTAKARRGGRCAALRDEEAFTSW 125
>FDHA_DESGI (Q934F5) Formate dehydrogenase alpha subunit precursor (EC 1.2.1.2)| (FDH alpha subunit) (Formate dehydrogenase large subunit) Length = 1012 Score = 28.5 bits (62), Expect = 9.4 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = -3 Query: 278 VALLRLVGSGVKRALMGERGREWSSWLVSR--APLWLAGERARADGRCCRLSDSE*PYGW 105 +A LR + +G K L RG+ W+ ++++ P + G++ G YGW Sbjct: 923 LATLRGIKNGDKVILESVRGKLWAKAIITKRIKPFAIQGQQVHMVGIPWH-------YGW 975 Query: 104 ----GGGVAGLASTPSMXXXXLGVP 42 GG A TPS+ G+P Sbjct: 976 SFPKNGGDAANILTPSVGDPNTGIP 1000 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.133 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,478,790 Number of Sequences: 219361 Number of extensions: 702707 Number of successful extensions: 2005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2004 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)