Clone Name | bastl46h07 |
---|---|
Clone Library Name | barley_pub |
>PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3| Length = 981 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = -1 Query: 363 RVPHHQLLISRYHSLVL-----TRSRPHPPQSHCLPVPKN 259 +V HHQLL+ + + + S+ PP HC+P+P + Sbjct: 316 KVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNH 355
>AMEL_MONDO (Q28462) Amelogenin| Length = 202 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 411 HHCLVYICSDNGSWTHRVPHHQLLISRYHSLVLTRSRPHPPQSHCLPVP 265 HH ++ + S S +H +P ++H ++ +P PPQ +PVP Sbjct: 47 HHQIIPVLSQQHSPSHSLP------PQHHIPIMAAQQPAPPQQPVMPVP 89
>MCM7_XENLA (Q91876) DNA replication licensing factor MCM7 (CDC47 homolog)| (x.MCM7) Length = 720 Score = 30.8 bits (68), Expect = 1.7 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 153 NSPFSAGSEPHPLHGRDSSLKTVEGNLQAAAAMASRF 263 N+ S + +P +GR + KTVE N+Q AA+ SRF Sbjct: 478 NARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRF 514
>SYH_PORPU (P51348) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 430 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +1 Query: 214 RQLKVIYKQQQPWRLVFGD----RETVTLRRMWTRSSQNKGVIARNQKL 348 +QLK +K++ L+ GD +ET+T++ M+T+ +N +I K+ Sbjct: 366 KQLKQAHKKRAIACLILGDNEIQQETITIKWMYTQEQENMSIIEFKNKI 414
>RT23_SCHPO (Q9UR07) Retrotransposable element Tf2 155 kDa protein type 3| Length = 1333 Score = 30.0 bits (66), Expect = 2.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 348 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 247 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT22_SCHPO (Q9C0R2) Retrotransposable element Tf2 155 kDa protein type 2| Length = 1333 Score = 30.0 bits (66), Expect = 2.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 348 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 247 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT21_SCHPO (Q05654) Retrotransposable element Tf2 155 kDa protein type 1| Length = 1333 Score = 30.0 bits (66), Expect = 2.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 348 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 247 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>IF38_ARATH (O49160) Eukaryotic translation initiation factor 3 subunit 8 (eIF3| p110) (eIF3c) (p105) Length = 900 Score = 30.0 bits (66), Expect = 2.8 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = +3 Query: 321 GSDSEKS-----EAGDGGRDGSKNRYLNKYTQDSDDSDTESHRVIRSLK 452 GS+SE E + D NRYL ++D DD+DT+ RV++ K Sbjct: 10 GSESEDESDYEVEVNEVQNDDVNNRYLQSGSEDDDDTDTK--RVVKPAK 56
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 16/48 (33%) Frame = -1 Query: 357 PHHQLLISRY------HSLVLTRSRPHPPQS----------HCLPVPK 262 PH L +S+ HSL++TR PH P S +CLP+P+ Sbjct: 227 PHLNLSVSKLESWGPVHSLLITRGLPHLPSSEKQQVSFHIPNCLPLPE 274
>AMELY_PANTR (Q861X8) Amelogenin, Y isoform precursor (Fragment)| Length = 203 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -1 Query: 411 HHCLVYICSDNGSWTHRVPHHQLLISRYHSLVLTRSRPHPPQSHCLPVPKNET 253 HH ++ + S TH + H +H V+ +P PQ +PVP ++ Sbjct: 77 HHQIIPVVSQQHPLTHTLQSH------HHIPVVPAQQPRVPQQAMMPVPGQQS 123
>RELN_MOUSE (Q60841) Reelin precursor (EC 3.4.21.-) (Reeler protein)| Length = 3461 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = -1 Query: 453 PSTSESRGGSQYQSHHCLVYICSDNGSW---THRVPHH 349 PS+S S G S +Q H +Y ++ SW T ++P H Sbjct: 3162 PSSSNSIGCSPFQFHEATIYNAVNSSSWKRITIQLPDH 3199
>RELN_RAT (P58751) Reelin precursor (EC 3.4.21.-)| Length = 3462 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = -1 Query: 453 PSTSESRGGSQYQSHHCLVYICSDNGSW---THRVPHH 349 PS+S S G S +Q H +Y ++ SW T ++P H Sbjct: 3163 PSSSNSIGCSPFQFHEATIYNAVNSSSWKRITIQLPDH 3200
>HEMA_CVMA5 (P31615) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 428 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -3 Query: 265 QKRDAMAAAACKLPSTVFKLESRPWSG*GSDPAENGE 155 ++ D M AAAC+LP F+ S +SG G+ A +G+ Sbjct: 309 RQSDNMTAAACQLPYCFFRNTSANYSG-GTHDAHHGD 344 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,704,773 Number of Sequences: 219361 Number of extensions: 941199 Number of successful extensions: 4259 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4247 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)