ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl46d08 |
|---|---|
| Clone Library Name | barley_pub |
>CARB_BUCAI (P57244) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1078 Score = 57.8 bits (138), Expect = 1e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSGTQAC+ Sbjct: 2 KSTDIKSILILGAGPIVIGQACEFDYSGTQACK 34 Score = 34.3 bits (77), Expect = 0.16 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 KKI+ILG GP IGQ EFDY A + Sbjct: 559 KKIIILGGGPNRIGQGIEFDYCCVHAAQ 586
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 57.4 bits (137), Expect = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 + KIMILGAGPI IGQACEFDYSGTQAC+ Sbjct: 7 LNKIMILGAGPIVIGQACEFDYSGTQACK 35 Score = 33.9 bits (76), Expect = 0.21 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +3 Query: 291 AAQDTAVTVRHFAA-EPTKGGKLAGVK-KIMILGAGPIAIGQACEFDY 428 AA+ A T +++ EP + L K K+MILG GP IGQ EFDY Sbjct: 532 AAEFEAFTPYYYSTYEPEECEVLPSDKPKVMILGGGPNRIGQGIEFDY 579
>CARB_BRUSU (Q8FZJ3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 57.0 bits (136), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSGTQAC+ Sbjct: 3 KRTDIKSILIIGAGPIVIGQACEFDYSGTQACK 35 Score = 37.7 bits (86), Expect = 0.015 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +3 Query: 324 FAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDY 428 F +P +++ KK++ILG GP IGQ EFDY Sbjct: 605 FVGQPRSEAEVSDRKKVVILGGGPNRIGQGIEFDY 639
>CARB_BRUME (Q8YIC2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 57.0 bits (136), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSGTQAC+ Sbjct: 3 KRTDIKSILIIGAGPIVIGQACEFDYSGTQACK 35 Score = 37.7 bits (86), Expect = 0.015 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +3 Query: 324 FAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDY 428 F +P +++ KK++ILG GP IGQ EFDY Sbjct: 605 FVGQPRSEAEVSDRKKVVILGGGPNRIGQGIEFDY 639
>CARB_RHIME (Q92PZ4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1163 Score = 56.6 bits (135), Expect = 3e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSGTQAC+ Sbjct: 3 KRQDIKSILIIGAGPIVIGQACEFDYSGTQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KK++ILG GP IGQ EFDY Sbjct: 620 KKVVILGGGPNRIGQGIEFDY 640
>CARB_AGRT5 (Q8UDE9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 56.6 bits (135), Expect = 3e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSGTQAC+ Sbjct: 3 KRQDIKSILIIGAGPIVIGQACEFDYSGTQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KK++ILG GP IGQ EFDY Sbjct: 620 KKVVILGGGPNRIGQGIEFDY 640
>CARB_RHILO (Q98I87) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1167 Score = 56.2 bits (134), Expect = 4e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +K I+I+GAGPI IGQACEFDYSGTQAC+ Sbjct: 7 IKSILIIGAGPIVIGQACEFDYSGTQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 324 FAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDY 428 FA +++ KK++ILG GP IGQ EFDY Sbjct: 611 FAGALANEAQVSSRKKVVILGGGPNRIGQGIEFDY 645
>CARB_RHOBA (Q7UJ58) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1083 Score = 56.2 bits (134), Expect = 4e-08 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +KKI+++G+GPI IGQACEFDYSGTQAC+ Sbjct: 7 IKKILLIGSGPIVIGQACEFDYSGTQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 336 PTKGGKLAGVKKIMILGAGPIAIGQACEFDY 428 P KG K K+++ILG GP IGQ EFDY Sbjct: 558 PAKGDK----KRVVILGGGPNRIGQGIEFDY 584
>CARB_SALTY (P14846) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1074 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIM+LG GP IGQ EFDY Sbjct: 560 KIMVLGGGPNRIGQGIEFDY 579
>CARB_SALTI (Q8Z9L7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1074 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIM+LG GP IGQ EFDY Sbjct: 560 KIMVLGGGPNRIGQGIEFDY 579
>CARB_ZYMMO (O50236) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1112 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ IMI+GAGPI IGQACEFDYSGTQAC+ Sbjct: 3 KRTDLQSIMIIGAGPIVIGQACEFDYSGTQACK 35 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +3 Query: 324 FAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 F EP + KK++ILG GP IGQ EFDY AC Sbjct: 579 FFGEPVCDSLPSNRKKVVILGGGPNRIGQGLEFDYCCCHAC 619
>CARB_SHIFL (P63738) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_PSEAE (P38100) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIMILG GP IGQ EFDY Sbjct: 558 EKIMILGGGPNRIGQGIEFDY 578
>CARB_ECOLI (P00968) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_ECOL6 (Q8FLB0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_ECO57 (P63737) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_YERPE (Q8ZIL4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 32.7 bits (73), Expect = 0.47 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 K+M+LG GP IGQ EFDY Sbjct: 560 KVMVLGGGPNRIGQGIEFDY 579
>CARB_BUCAP (Q8K9Z7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 2 KSTDIKSILILGAGPIVIGQACEFDYSGAQACK 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 330 AEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 + PTK KKI+++G GP IGQ EFDY A + Sbjct: 553 SHPTKN-----TKKIIVIGGGPNRIGQGIEFDYCCVHAAQ 587
>CARB_PSESM (Q87WP4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIMILG GP IGQ EFDY Sbjct: 560 KIMILGGGPNRIGQGIEFDY 579
>CARB_PSEPK (Q88DU6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 55.8 bits (133), Expect = 5e-08 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIKSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIMILG GP IGQ EFDY Sbjct: 560 KIMILGGGPNRIGQGIEFDY 579
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 55.5 bits (132), Expect = 7e-08 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 ++KI++LG+GPI IGQACEFDYSGTQAC+ Sbjct: 7 IQKILLLGSGPIVIGQACEFDYSGTQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 357 AGVKKIMILGAGPIAIGQACEFDY 428 A K+MILG GP IGQ EFDY Sbjct: 555 ASKPKVMILGGGPNRIGQGIEFDY 578
>CARB_BUCBP (P59448) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 54.7 bits (130), Expect = 1e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +K I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 7 IKSILILGAGPIIIGQACEFDYSGAQACK 35 Score = 34.3 bits (77), Expect = 0.16 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 KKI+ILG GP IGQ EFDY A + Sbjct: 560 KKIIILGGGPNRIGQGIEFDYCCVHAAQ 587
>CARB_CORGL (P58939) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1113 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + + ++++G+GPI IGQACEFDYSGTQACR Sbjct: 3 KRSDINHVLVIGSGPIVIGQACEFDYSGTQACR 35 Score = 38.5 bits (88), Expect = 0.009 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 6/63 (9%) Frame = +3 Query: 291 AAQDTAVTVRHFAA---EPTKGGKLAGV---KKIMILGAGPIAIGQACEFDYSGTQACRR 452 AA+ A T H++A +P ++A +K++ILG+GP IGQ EFDYS A Sbjct: 541 AAEFEAKTPYHYSAYELDPAAESEVAPQTEREKVLILGSGPNRIGQGIEFDYSCVHAALE 600 Query: 453 SSR 461 SR Sbjct: 601 LSR 603
>CARB_RALSO (Q8XZ83) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIKTILIIGAGPIIIGQACEFDYSGAQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KKIM+LG GP IGQ EFDY Sbjct: 564 KKIMVLGGGPNRIGQGIEFDY 584
>CARB_BACHD (Q9K9V9) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1062 Score = 54.3 bits (129), Expect = 2e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +3 Query: 348 GKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 GK +KKI+++G+GPI IGQA EFDY+GTQAC+ Sbjct: 2 GKREDIKKILVIGSGPIVIGQAAEFDYAGTQACQ 35 Score = 35.4 bits (80), Expect = 0.073 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 K I++LG+GPI IGQ EFDY+ Sbjct: 552 KSILVLGSGPIRIGQGIEFDYA 573
>CARB1_AQUAE (O67869) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 557 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +KKI+I+G+GPI IGQA EFDYSGTQAC+ Sbjct: 3 KRTDIKKILIIGSGPIVIGQAAEFDYSGTQACK 35
>CARB_VIBCH (Q9KPH9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIQSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIM+LG GP IGQ EFDY Sbjct: 560 KIMVLGGGPNRIGQGIEFDY 579
>CARB_NEIMB (Q9JXW8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLKSILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KK+MILG GP IGQ EFDY Sbjct: 554 KKVMILGGGPNRIGQGIEFDY 574
>CARB_NEIMA (Q9JW02) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLKSILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KK+MILG GP IGQ EFDY Sbjct: 554 KKVMILGGGPNRIGQGIEFDY 574
>CARB_NEIGO (Q59599) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLKSILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 37.7 bits (86), Expect = 0.015 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 KK+MILGAGP IGQ EFDY A Sbjct: 554 KKVMILGAGPNPIGQGIEFDYCSVHA 579
>CARB_VIBVY (Q7MNU0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIQSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_VIBVU (Q8DEM2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIQSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIM+LG GP IGQ EFDY Sbjct: 559 EKIMVLGGGPNRIGQGIEFDY 579
>CARB_VIBPA (Q87SF3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+ILGAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIQSILILGAGPIVIGQACEFDYSGAQACK 35 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIM+LG GP IGQ EFDY Sbjct: 560 KIMVLGGGPNRIGQGIEFDY 579
>CARB_XANCP (P58943) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 53.9 bits (128), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLKTILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIMILG GP IGQ EFDY Sbjct: 561 KIMILGGGPNRIGQGIEFDY 580
>CARB_HALER (Q8RSS3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 53.5 bits (127), Expect = 3e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDIQSILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIM+LG GP IGQ EFDY Sbjct: 560 KIMVLGGGPNRIGQGIEFDY 579
>CARB_STRA5 (Q8DZQ7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDYSGTQAC Sbjct: 3 KRTDIRKIMVIGSGPIVIGQAAEFDYSGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYS 431 I++LG+GPI IGQ EFDY+ Sbjct: 554 ILVLGSGPIRIGQGVEFDYA 573
>CARB_STRA3 (Q8E5F5) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDYSGTQAC Sbjct: 3 KRTDIRKIMVIGSGPIVIGQAAEFDYSGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYS 431 I++LG+GPI IGQ EFDY+ Sbjct: 554 ILVLGSGPIRIGQGVEFDYA 573
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDISSILIIGAGPIVIGQACEFDYSGVQACK 35 Score = 32.3 bits (72), Expect = 0.62 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 357 AGVKKIMILGAGPIAIGQACEFDY 428 + KK +ILG GP IGQ EFDY Sbjct: 565 SAAKKAVILGGGPNRIGQGIEFDY 588
>CARB_XYLFT (Q87EB8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 52.8 bits (125), Expect = 4e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLRTILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIMILG GP IGQ EFDY Sbjct: 560 RKIMILGGGPNRIGQGIEFDY 580
>CARB_XYLFA (Q9PEC1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 52.8 bits (125), Expect = 4e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLRTILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +KIMILG GP IGQ EFDY Sbjct: 560 RKIMILGGGPNRIGQGIEFDY 580
>CARB_PASMU (Q9CKV0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1068 Score = 52.8 bits (125), Expect = 4e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDINTILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 35.4 bits (80), Expect = 0.073 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KKIMILG GP IGQ EFDY Sbjct: 554 KKIMILGGGPNRIGQGIEFDY 574
>CARB_XANAC (P58942) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 52.4 bits (124), Expect = 6e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+I+GAGPI IGQACEFDYSG QAC+ Sbjct: 3 KRTDLETILIIGAGPIVIGQACEFDYSGAQACK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDY 428 KIMILG GP IGQ EFDY Sbjct: 561 KIMILGGGPNRIGQGIEFDY 580
>CARB_MYCTU (P57689) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1115 Score = 52.4 bits (124), Expect = 6e-07 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 ++++G+GPI IGQACEFDYSGTQACR Sbjct: 10 VLVIGSGPIVIGQACEFDYSGTQACR 35 Score = 34.7 bits (78), Expect = 0.12 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQACRRSSR 461 K++ILG+GP IGQ EFDYS A S+ Sbjct: 567 KVLILGSGPNRIGQGIEFDYSCVHAATTLSQ 597
>CARB_MYCBO (Q7U054) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1115 Score = 52.4 bits (124), Expect = 6e-07 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 ++++G+GPI IGQACEFDYSGTQACR Sbjct: 10 VLVIGSGPIVIGQACEFDYSGTQACR 35 Score = 34.7 bits (78), Expect = 0.12 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQACRRSSR 461 K++ILG+GP IGQ EFDYS A S+ Sbjct: 567 KVLILGSGPNRIGQGIEFDYSCVHAATTLSQ 597
>CARB_LACLA (Q9CFV2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 52.4 bits (124), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +KKIMI+G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKKIMIIGSGPIIIGQAAEFDYAGTQAC 34 Score = 36.2 bits (82), Expect = 0.043 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYS 431 K + +KI++LG+GPI IGQ EFDY+ Sbjct: 547 KRSSKEKIIVLGSGPIRIGQGVEFDYA 573
>CARB_CLOPE (Q8XHB3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1067 Score = 52.0 bits (123), Expect = 8e-07 Identities = 20/29 (68%), Positives = 27/29 (93%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +KK++++G+GPI IGQA EFDYSGTQAC+ Sbjct: 7 IKKVLVIGSGPIIIGQAAEFDYSGTQACQ 35 Score = 36.6 bits (83), Expect = 0.033 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACRRSSRK 464 KK++++G+GPI IGQ EFDY+ C + RK Sbjct: 555 KKVVVIGSGPIRIGQGIEFDYASVH-CVMALRK 586
>CARB_HELPY (O25577) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1085 Score = 52.0 bits (123), Expect = 8e-07 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + I+++G+GPI IGQACEFDYSGTQ+C+ Sbjct: 3 KRTDISNILLIGSGPIVIGQACEFDYSGTQSCK 35 Score = 33.9 bits (76), Expect = 0.21 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KKI+I+G+GP IGQ EFDY Sbjct: 559 KKILIIGSGPNRIGQGIEFDY 579
>CARB_HELPJ (Q9ZKT2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1085 Score = 52.0 bits (123), Expect = 8e-07 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + I+++G+GPI IGQACEFDYSGTQ+C+ Sbjct: 3 KRTDISNILLIGSGPIVIGQACEFDYSGTQSCK 35 Score = 33.9 bits (76), Expect = 0.21 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KKI+I+G+GP IGQ EFDY Sbjct: 559 KKILIIGSGPNRIGQGIEFDY 579
>CARB_ARCFU (O28994) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 52.0 bits (123), Expect = 8e-07 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++KIM++G+GPI IGQA EFDYSG+QAC+ Sbjct: 3 KREDIRKIMVIGSGPIVIGQAAEFDYSGSQACK 35 Score = 36.6 bits (83), Expect = 0.033 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KK+MILGAGP IGQ EFDY Sbjct: 561 KKVMILGAGPNRIGQGIEFDY 581
>CARB_CAMJE (Q9PIL7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1089 Score = 51.6 bits (122), Expect = 1e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K I+++G+GPI IGQACEFDYSGTQA + Sbjct: 3 KRTDIKSILLIGSGPIVIGQACEFDYSGTQAAK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 KK+MI+G GP IGQ EFDY+ A Sbjct: 561 KKVMIIGGGPNRIGQGIEFDYACVHA 586
>CARB_LEPIN (Q8F832) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 51.6 bits (122), Expect = 1e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACRRSSRK 464 ++ ++ILG+GPI IGQACEFDYSGTQA + K Sbjct: 7 IRSVLILGSGPIVIGQACEFDYSGTQAAKALKEK 40 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 354 LAGVKKIMILGAGPIAIGQACEFDYSGTQA 443 + K +MILG GP IGQ EFDY QA Sbjct: 584 VTNAKSVMILGGGPNRIGQGIEFDYCCCQA 613
>CARB_LEPIC (Q72NF1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 51.6 bits (122), Expect = 1e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACRRSSRK 464 ++ ++ILG+GPI IGQACEFDYSGTQA + K Sbjct: 7 IRSVLILGSGPIVIGQACEFDYSGTQAAKALKEK 40 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 354 LAGVKKIMILGAGPIAIGQACEFDYSGTQA 443 + K +MILG GP IGQ EFDY QA Sbjct: 584 VTNAKSVMILGGGPNRIGQGIEFDYCCCQA 613
>CARB_LACPL (P77886) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 51.6 bits (122), Expect = 1e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K + KIM++G+GPI IGQA EFDYSGTQAC Sbjct: 3 KRTDIHKIMVIGSGPIIIGQAAEFDYSGTQAC 34 Score = 33.1 bits (74), Expect = 0.36 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYS 431 +++LG+GPI IGQ EFDY+ Sbjct: 554 VLVLGSGPIRIGQGVEFDYA 573
>CARB_STRCO (Q9KXR6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1102 Score = 51.2 bits (121), Expect = 1e-06 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ ++++G+GPI IGQA EFDYSGTQACR Sbjct: 3 KRTDIQSVLVIGSGPIVIGQAAEFDYSGTQACR 35 Score = 32.0 bits (71), Expect = 0.81 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQA 443 ++ILG+GP IGQ EFDYS A Sbjct: 561 VIILGSGPNRIGQGIEFDYSCVHA 584
>CARB_STRAW (Q827Q7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1102 Score = 51.2 bits (121), Expect = 1e-06 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ ++++G+GPI IGQA EFDYSGTQACR Sbjct: 3 KRTDIQSVLVIGSGPIVIGQAAEFDYSGTQACR 35 Score = 32.0 bits (71), Expect = 0.81 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQA 443 ++ILG+GP IGQ EFDYS A Sbjct: 561 VIILGSGPNRIGQGIEFDYSCVHA 584
>CARB_THETN (Q8RBK0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 51.2 bits (121), Expect = 1e-06 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + K++++G+GPI IGQA EFDYSGTQAC+ Sbjct: 3 KYKDISKVLVIGSGPIIIGQAAEFDYSGTQACK 35 Score = 35.8 bits (81), Expect = 0.056 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQA 443 + K++++G+GPI IGQ EFDY +A Sbjct: 551 IPKVIVIGSGPIRIGQGIEFDYCSVKA 577
>CARB_STRR6 (Q8CWR0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRTDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + +++LG+GPI IGQ EFDY+ Sbjct: 552 ESVLVLGSGPIRIGQGVEFDYA 573
>CARB_STRPN (Q97QE4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRTDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + +++LG+GPI IGQ EFDY+ Sbjct: 552 ESVLVLGSGPIRIGQGVEFDYA 573
>CARB_LACLC (O32771) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +KKIMI+G+GPI IGQA EFDY+GT+AC Sbjct: 7 IKKIMIIGSGPIIIGQAAEFDYAGTEAC 34 Score = 35.8 bits (81), Expect = 0.056 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYS 431 K + +KI++LG+GPI IGQ EFDY+ Sbjct: 547 KRSDKEKIIVLGSGPIRIGQGVEFDYA 573
>CARB_MYCLE (Q9CCR2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1121 Score = 51.2 bits (121), Expect = 1e-06 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 ++++G+GPI IGQACEFDY+GTQACR Sbjct: 10 VLVIGSGPIVIGQACEFDYAGTQACR 35 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQA 443 K++ILG+GP IGQ EFDYS A Sbjct: 567 KVLILGSGPNRIGQGIEFDYSCVHA 591
>CARB_METMA (P58944) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +KK++++G+GPI IGQA EFD+SG+QACR Sbjct: 3 KREDIKKVLLIGSGPITIGQAAEFDFSGSQACR 35 Score = 39.7 bits (91), Expect = 0.004 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAA-EPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQA 443 AA+ A T +++ E T KKI+ILGAGPI IGQ EFDY A Sbjct: 520 AAEFEAATPYYYSTYEDTCETNSTDKKKILILGAGPIRIGQGIEFDYCTVHA 571
>CARB_STRP8 (P58941) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRKDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + I++LG+GPI IGQ EFDY+ Sbjct: 552 ESILVLGSGPIRIGQGVEFDYA 573
>CARB_STRP6 (Q5XCR6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRKDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + I++LG+GPI IGQ EFDY+ Sbjct: 552 ESILVLGSGPIRIGQGVEFDYA 573
>CARB_STRP3 (Q8K7Y3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRKDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + I++LG+GPI IGQ EFDY+ Sbjct: 552 ESILVLGSGPIRIGQGVEFDYA 573
>CARB_STRP1 (Q9A0C6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 50.8 bits (120), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++KIM++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRKDIQKIMVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + I++LG+GPI IGQ EFDY+ Sbjct: 552 ESILVLGSGPIRIGQGVEFDYA 573
>CARB_METAC (Q8TNY4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +KK++++G+GPI IGQA EFD+SG+QACR Sbjct: 3 KREDIKKVLLIGSGPITIGQAAEFDFSGSQACR 35 Score = 38.9 bits (89), Expect = 0.007 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 KKI+ILGAGPI IGQ EFDY A Sbjct: 546 KKILILGAGPIRIGQGIEFDYCTVHA 571
>CARB1_METJA (Q58773) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 482 Score = 50.4 bits (119), Expect = 2e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = +3 Query: 354 LAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 + +KK+M+ G+GPI IGQA EFD+SG+QAC+ Sbjct: 1 MESIKKVMVFGSGPIVIGQAAEFDFSGSQACK 32
>CARB_BACSU (P25994) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 49.7 bits (117), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K + KI+++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRVDINKILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 36.2 bits (82), Expect = 0.043 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 K +M+LG+GPI IGQ EFDY+ Sbjct: 552 KSVMVLGSGPIRIGQGVEFDYA 573
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 49.7 bits (117), Expect = 4e-06 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +KK++I+G+GP IGQA EFDYSGTQAC+ Sbjct: 7 IKKVLIIGSGPNNIGQAAEFDYSGTQACK 35 Score = 35.8 bits (81), Expect = 0.056 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 KKI+++G+GPI IGQ EFDY Sbjct: 554 KKIVVIGSGPIRIGQGIEFDY 574
>CARB_METTH (O27077) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 49.3 bits (116), Expect = 5e-06 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 + K++I+G+GPI IGQA EFDYSG+QAC+ Sbjct: 7 INKVLIIGSGPIQIGQAAEFDYSGSQACK 35 Score = 35.0 bits (79), Expect = 0.095 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +K++I+G+GPI IGQ EFDY Sbjct: 545 RKVLIIGSGPIRIGQGIEFDY 565
>CARB_THET2 (P96495) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1028 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +KKI+I+G+GPI IGQA EFDYSGTQA + Sbjct: 7 LKKILIIGSGPITIGQAAEFDYSGTQAVK 35 Score = 36.6 bits (83), Expect = 0.033 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ A T H++ + K K++ILG+GPI IGQ EFDY+ A Sbjct: 529 AAEFEAYTPYHYSTYELEDEVWPSQKPKVVILGSGPIRIGQGVEFDYATVHA 580
>CARB_LISMO (Q8Y665) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 48.9 bits (115), Expect = 6e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIVIGQAAEFDYAGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 333 EPTKGGKLAGVKKIMILGAGPIAIGQACEFDYS 431 E T+ K + +++LG+GPI IGQ EFDY+ Sbjct: 545 ESTRSAK----ESVIVLGSGPIRIGQGVEFDYA 573
>CARB_LISMF (Q71YI1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 48.9 bits (115), Expect = 6e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIVIGQAAEFDYAGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 333 EPTKGGKLAGVKKIMILGAGPIAIGQACEFDYS 431 E T+ K + +++LG+GPI IGQ EFDY+ Sbjct: 545 ESTRSAK----ESVIVLGSGPIRIGQGVEFDYA 573
>CARB_LISIN (Q92AH3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 48.9 bits (115), Expect = 6e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIVIGQAAEFDYAGTQAC 34 Score = 33.1 bits (74), Expect = 0.36 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 + +++LG+GPI IGQ EFDY+ Sbjct: 552 ESVIVLGSGPIRIGQGVEFDYA 573
>CARB_FUSNN (Q8RG86) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 48.9 bits (115), Expect = 6e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRKDIKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.4 bits (85), Expect = 0.019 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = +3 Query: 324 FAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQA 443 F E T+ K +KI++LG+GPI IGQ EFDY+ A Sbjct: 542 FENESTRSDK----EKIVVLGSGPIRIGQGIEFDYATVHA 577
>CARB_THEMA (Q9WZ27) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 48.5 bits (114), Expect = 8e-06 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K +K+I+++G+GPI IGQA EFDYSGTQA + Sbjct: 3 KREDIKRILVIGSGPITIGQAAEFDYSGTQALK 35 Score = 34.7 bits (78), Expect = 0.12 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 +KIMILG+GP IGQ EFDY+ Sbjct: 547 EKIMILGSGPNRIGQGIEFDYT 568
>CARB_HAEDU (Q7VP67) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1075 Score = 48.5 bits (114), Expect = 8e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + I+I+GAGPI IGQACEFDYSG QA + Sbjct: 3 KRTDINTILIIGAGPIIIGQACEFDYSGAQAVK 35 Score = 33.5 bits (75), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDY 428 +K+MILG GP IGQ EFDY Sbjct: 554 QKVMILGGGPNRIGQGIEFDY 574
>CARB_STAAW (P58940) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_STAAS (Q6GA10) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_STAAR (Q6GHN2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_STAAN (P63740) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_STAAM (P63739) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_STAAC (Q5HGM9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESSTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_THEVO (Q97AJ3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1044 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K + KI+++G+GP+ IGQA EFDYS +QACR Sbjct: 3 KREDISKILVIGSGPVVIGQAAEFDYSASQACR 35
>CARB_STAES (Q8CPJ4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 48.1 bits (113), Expect = 1e-05 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 +K I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IKTILVVGSGPIIIGQAAEFDYAGTQAC 34 Score = 36.6 bits (83), Expect = 0.033 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 +KI++LG+GPI IGQ EFDY+ A Sbjct: 552 EKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_BACCL (P46537) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++ I+++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRRDIETILVIGSGPIVIGQAAEFDYAGTQAC 34 Score = 34.3 bits (77), Expect = 0.16 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYS 431 AA+ T+ T +++ + + K +++LG+GPI IGQ EFDY+ Sbjct: 526 AAEFTSETPYYYSTYEEENESIVTEKPSVIVLGSGPIRIGQGIEFDYA 573
>CARB1_METKA (Q8TWX0) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 564 Score = 47.8 bits (112), Expect = 1e-05 Identities = 18/27 (66%), Positives = 25/27 (92%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQACR 449 K++I+G+GPI +GQA EFDYSG+QAC+ Sbjct: 7 KVLIIGSGPIIVGQAAEFDYSGSQACK 33
>CARB_BACST (O50302) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++ I+++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRRDIETILVIGSGPIVIGQAAEFDYAGTQAC 34 Score = 34.3 bits (77), Expect = 0.16 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYS 431 AA+ T+ T +++ + + K +++LG+GPI IGQ EFDY+ Sbjct: 526 AAEFTSETPYYYSTYEEENESIVTEKPSVIVLGSGPIRIGQGIEFDYA 573
>CARB_STAS1 (Q49WY4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 47.4 bits (111), Expect = 2e-05 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++ I+++G+GPI IGQA EFDY+GTQAC Sbjct: 3 KRQDIETILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 36.6 bits (83), Expect = 0.033 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 +KI++LG+GPI IGQ EFDY+ A Sbjct: 552 EKILVLGSGPIRIGQGVEFDYATVHA 577
>CARY_BACSU (P18185) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1030 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K + I+++G+GPI IGQA EFDYSGTQ C Sbjct: 3 KDTSISSILVIGSGPIIIGQAAEFDYSGTQGC 34 Score = 35.0 bits (79), Expect = 0.095 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYS 431 K+ +I+G+GPI IGQ EFDYS Sbjct: 556 KRALIIGSGPIRIGQGVEFDYS 577
>PYR1_EMENI (O93937) Protein pyrABCN [Includes: Glutamine-dependent| carbamoyl-phosphate (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2275 Score = 47.0 bits (110), Expect = 2e-05 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = +3 Query: 330 AEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 AE K VKK++ILG+G ++IGQA EFDYSG+QA + Sbjct: 469 AENIKASPRVSVKKVLILGSGGLSIGQAGEFDYSGSQAIK 508
>CARB_HALSA (Q9HP43) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1042 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 + I+++G+GPI IGQA EFDYSG QACR Sbjct: 6 RTILLIGSGPIQIGQAAEFDYSGAQACR 33 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 ++I+G GPI IGQ EFDY A R Sbjct: 566 VVIVGGGPIRIGQGVEFDYCTVHAVR 591
>CARB_STAHJ (Q4L5Q5) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 47.0 bits (110), Expect = 2e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 ++ I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IQTILVIGSGPIIIGQAAEFDYAGTQAC 34 Score = 37.7 bits (86), Expect = 0.015 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 291 AAQDTAVTVRHFAAEPTKGGKLAGVK-KIMILGAGPIAIGQACEFDYSGTQA 443 AA+ + T ++ T+ + K KI++LG+GPI IGQ EFDY+ A Sbjct: 526 AAEFESTTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHA 577
>CARB_THEAC (Q9HK17) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1047 Score = 47.0 bits (110), Expect = 2e-05 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 + +I+++G+GP+ IGQA EFDYSG+QAC Sbjct: 7 IHRILVIGSGPVVIGQAAEFDYSGSQAC 34 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQA 443 IMI+G+GP I Q EFDY +A Sbjct: 546 IMIIGSGPNRIAQGLEFDYGSVKA 569
>PYR1_HUMAN (P27708) CAD protein [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2225 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = +3 Query: 336 PTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 PT G L +K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 384 PTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIK 421
>CARB_STAEQ (Q5HPY8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 46.6 bits (109), Expect = 3e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 ++ I+++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IQTILVVGSGPIIIGQAAEFDYAGTQAC 34 Score = 36.6 bits (83), Expect = 0.033 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 +KI++LG+GPI IGQ EFDY+ A Sbjct: 552 EKILVLGSGPIRIGQGVEFDYATVHA 577
>CARY_BACHD (Q9K8V7) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1047 Score = 46.2 bits (108), Expect = 4e-05 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K ++ ++++G+GPI IGQA EFDY+G QAC Sbjct: 3 KRTDIQSVLVIGSGPIVIGQAAEFDYAGAQAC 34 Score = 33.9 bits (76), Expect = 0.21 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 ++++I+G+GPI IGQ EFDY + Sbjct: 557 ERVLIIGSGPIRIGQGIEFDYCSVHGAK 584
>CARB_DEIRA (Q9RWK0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1024 Score = 46.2 bits (108), Expect = 4e-05 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 K ++ I+ILG+GPI IGQA EFDYSGTQA + Sbjct: 3 KRTDLQTILILGSGPIQIGQAAEFDYSGTQALK 35 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQA 443 K++ILG+GP IGQ EFDY+ A Sbjct: 553 KVVILGSGPNRIGQGVEFDYATVHA 577
>CARY_LACPL (Q9RLS9) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1020 Score = 45.4 bits (106), Expect = 7e-05 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQAC 446 + I ++G+GPI IGQA EFDY+GTQAC Sbjct: 7 IHSIAVIGSGPIKIGQAAEFDYAGTQAC 34 Score = 33.5 bits (75), Expect = 0.28 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYS 431 I++LG+GPI IGQ EFDY+ Sbjct: 552 ILVLGSGPIRIGQGIEFDYT 571
>CPSM_HUMAN (P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 44.3 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = +3 Query: 306 AVTVRHFAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 A T+ +P V K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 403 ATTITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVK 450 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 +M+LG GP IG + EFD+ + R Sbjct: 976 MMVLGCGPYHIGSSVEFDWCAVSSIR 1001
>CARB_YEAST (P03965) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1118 Score = 44.3 bits (103), Expect = 2e-04 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = +3 Query: 303 TAVTVRHFAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 T T F E K + GV ++++G+G ++IGQA EFDYSG+QA + Sbjct: 8 TEPTNSAFTTEDYKPQLVEGVNSVLVIGSGGLSIGQAGEFDYSGSQAIK 56
>CPSM_RANCA (Q91293) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1496 Score = 43.9 bits (102), Expect = 2e-04 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +3 Query: 312 TVRHFAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 T+ +P K V K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 402 TLTSVMPKPALQSKRIDVAKVLILGSGGLSIGQAGEFDYSGSQAVK 447 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 +M+LG GP IG + EFD+ + R Sbjct: 973 MMVLGCGPYHIGSSVEFDWCAVSSIR 998
>PYR1_DICDI (P20054) Protein PYR1-3 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2185 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/30 (60%), Positives = 26/30 (86%) Frame = +3 Query: 360 GVKKIMILGAGPIAIGQACEFDYSGTQACR 449 G+ K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 364 GINKVLILGSGGLSIGQAGEFDYSGSQAIK 393
>CPSM_RAT (P07756) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 42.7 bits (99), Expect = 5e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +3 Query: 312 TVRHFAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 T+ +P V K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 405 TITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVK 450 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 IM+LG GP IG + EFD+ + R Sbjct: 976 IMVLGCGPYHIGSSVEFDWCAVSSIR 1001
>CPSM_MOUSE (Q8C196) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 42.7 bits (99), Expect = 5e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +3 Query: 312 TVRHFAAEPTKGGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 T+ +P V K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 405 TITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEFDYSGSQAVK 450 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 372 IMILGAGPIAIGQACEFDYSGTQACR 449 IM+LG GP IG + EFD+ + R Sbjct: 976 IMVLGCGPYHIGSSVEFDWCAVSSIR 1001
>CARB_SULAC (Q4J8E8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1052 Score = 42.7 bits (99), Expect = 5e-04 Identities = 16/29 (55%), Positives = 25/29 (86%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 VK+++++G+GPI I +A EFDYSG+QA + Sbjct: 5 VKRVLVIGSGPIKIAEAAEFDYSGSQALK 33 Score = 29.6 bits (65), Expect = 4.0 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +3 Query: 360 GVKKIMILGAGPIAIGQACEFDY 428 G++K++I+GAG IG + EFD+ Sbjct: 553 GIRKLLIVGAGGFRIGVSVEFDW 575
>CARB_SULTO (Q970U7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1049 Score = 42.7 bits (99), Expect = 5e-04 Identities = 16/29 (55%), Positives = 25/29 (86%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 V+K++++G+GPI I +A EFDYSG+QA + Sbjct: 5 VRKVLVIGSGPIKIAEAAEFDYSGSQALK 33
>CARB_SULSO (Q59969) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1051 Score = 42.4 bits (98), Expect = 6e-04 Identities = 16/28 (57%), Positives = 24/28 (85%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 KK++++G+GPI I +A EFDYSG+QA + Sbjct: 6 KKVLVIGSGPIKIAEAAEFDYSGSQALK 33
>PYR1_SCHPO (Q09794) Protein ura1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2244 Score = 42.4 bits (98), Expect = 6e-04 Identities = 18/32 (56%), Positives = 26/32 (81%) Frame = +3 Query: 354 LAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 L K+++ILG+G ++IGQA EFDYSG+QA + Sbjct: 471 LVDAKRVLILGSGGLSIGQAGEFDYSGSQAIK 502 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 K +M+LG+G IG + EFD+ +A R Sbjct: 1014 KGVMVLGSGVYRIGSSVEFDWCAVRAVR 1041
>CARB_TRICU (P46056) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1176 Score = 42.4 bits (98), Expect = 6e-04 Identities = 17/29 (58%), Positives = 26/29 (89%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 VKK++++G+G ++IGQA EFDYSG+QA + Sbjct: 75 VKKVLVVGSGGLSIGQAGEFDYSGSQAIK 103
>PYR1_MESAU (P08955) CAD protein [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2225 Score = 42.4 bits (98), Expect = 6e-04 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +3 Query: 345 GGKLAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 G L +K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 387 GSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIK 421
>PYR1_YEAST (P07259) Protein URA1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2214 Score = 42.0 bits (97), Expect = 8e-04 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 KK+++LG+G ++IGQA EFDYSG+QA + Sbjct: 439 KKVLVLGSGGLSIGQAGEFDYSGSQAIK 466
>CARB_SCHPO (O94313) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1160 Score = 41.6 bits (96), Expect = 0.001 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 VKK++++G+G ++IGQA EFDYSG QA + Sbjct: 86 VKKVVVVGSGGLSIGQAGEFDYSGAQAIK 114 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 375 MILGAGPIAIGQACEFDYSGTQACRRSSRK 464 M+LG+G IG + EFD+ G +C R+ RK Sbjct: 632 MVLGSGVYRIGSSVEFDWCGV-SCARTLRK 660
>CARB_ASHGO (Q75D66) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1113 Score = 41.2 bits (95), Expect = 0.001 Identities = 16/32 (50%), Positives = 26/32 (81%) Frame = +3 Query: 354 LAGVKKIMILGAGPIAIGQACEFDYSGTQACR 449 + G+ ++I+G+G ++IGQA EFDYSG+QA + Sbjct: 25 IKGIDSVLIIGSGGLSIGQAGEFDYSGSQAIK 56
>PYR1_DROME (P05990) CAD protein (Protein rudimentary) [Includes:| Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2224 Score = 41.2 bits (95), Expect = 0.001 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQACR 449 +K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 404 RKVLILGSGGLSIGQAGEFDYSGSQAIK 431
>CARB_PYRFU (Q8U085) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1056 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/29 (55%), Positives = 24/29 (82%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 V K++++G+G I IG+A EFDYSG+QA + Sbjct: 5 VSKVIVIGSGAIKIGEAAEFDYSGSQALK 33
>CARB_PYRAE (Q8ZY48) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1024 Score = 40.4 bits (93), Expect = 0.002 Identities = 15/29 (51%), Positives = 24/29 (82%) Frame = +3 Query: 363 VKKIMILGAGPIAIGQACEFDYSGTQACR 449 +KKI+++G+G I + +A EFDYSG+QA + Sbjct: 3 IKKILVIGSGAIKVAEAAEFDYSGSQALK 31
>PYR1_SQUAC (Q91437) CAD protein [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2242 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/27 (62%), Positives = 24/27 (88%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQACR 449 K++ILG+G ++IGQA EFDYSG+QA + Sbjct: 398 KVLILGSGGLSIGQAGEFDYSGSQAIK 424
>CARY_BACST (Q9ZB63) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1043 Score = 39.7 bits (91), Expect = 0.004 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +3 Query: 357 AGVKKIMILGAGPIAIGQACEFDYSGTQA 443 +G +K++I+GAGPI IGQ EFDYS + Sbjct: 554 SGKEKVLIIGAGPIRIGQGIEFDYSSVHS 582 Score = 37.0 bits (84), Expect = 0.025 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = +3 Query: 351 KLAGVKKIMILGAGPIAIGQACEFDYSGTQAC 446 K + ++ I+++G+G + +A EFDYSGTQAC Sbjct: 3 KDSSLQSILLIGSGRSSSAKAAEFDYSGTQAC 34
>CARB2_METJA (Q58776) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 618 Score = 38.9 bits (89), Expect = 0.007 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 KK++I+G+GPI IGQ EFDYS A Sbjct: 85 KKVIIIGSGPIRIGQGIEFDYSSVHA 110
>CARB2_AQUAE (O67233) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 537 Score = 34.7 bits (78), Expect = 0.12 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 366 KKIMILGAGPIAIGQACEFDYSGTQA 443 KK++ILG+GP IGQ EFDY+ A Sbjct: 3 KKVVILGSGPNRIGQGIEFDYACVHA 28
>CARB2_METKA (Q8TUT7) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 542 Score = 32.7 bits (73), Expect = 0.47 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 369 KIMILGAGPIAIGQACEFDYSGTQA 443 K++++GAGP IGQ EFDY A Sbjct: 4 KVLVIGAGPNRIGQGIEFDYCTVHA 28
>SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domain-containing| Eph receptor-binding protein 1) (Cas/HEF1-associated signal transducer) Length = 854 Score = 31.6 bits (70), Expect = 1.1 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 5 LHAPLIPLQKNPTSPSPPSTLHFAAASSSPPTLCAP 112 LH+PL P+ ++P+SP+ + A S++P T P Sbjct: 398 LHSPLSPISESPSSPAYSTVTRVHAPSATPSTSAQP 433
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 11 APLIPLQKNPTSPSPPSTLHFAAASSSPPTLCAPP 115 A L P P +PSPP L ++S PP LC PP Sbjct: 399 AKLPPPPLTPPAPSPPPPLP-PPSTSPPPPLCPPP 432
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 11 APLIPLQKNPTSPSPPSTLHFAAASSSPPTLCAP 112 AP P +P SP+PPS A S SPP+ P Sbjct: 112 APPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPP 145
>SH2D3_HUMAN (Q8N5H7) SH2 domain-containing protein 3C (Novel SH2-containing| protein 3) Length = 860 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 5 LHAPLIPLQKNPTSP--SPPSTLHFAAASSSPPTLCAPP 115 LH+P+ P+ ++P+SP S + +H A A+ S L A P Sbjct: 403 LHSPMSPISESPSSPAYSTVTRVHAAPAAPSATALPASP 441
>PCD15_MOUSE (Q99PJ1) Protocadherin-15 precursor| Length = 1943 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 23 PLQKNPTSPSPPSTLHFAAASSSPPTLCAP 112 PL +P +P PP + F+ S+PPT P Sbjct: 1767 PLPLSPPNPPPPQLVTFSLPISTPPTSSLP 1796
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 8 HAPLIPLQKNPTSPSPPSTLHFAAASSSPPTLCAP 112 H IP+ +PTSP PP T S PP +P Sbjct: 217 HRQAIPVLHSPTSPEPPDT-----TSPEPPNTTSP 246
>SFRP1_BOVIN (O19116) Secreted frizzled-related protein 1 precursor (sFRP-1)| (Frizzled in aorta protein) (FrzA protein) Length = 308 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 345 GGKLAGVKKIMILGAGPIAIGQACEFDYSGTQA 443 GG+ A ++ L AG +A G A E+DY Q+ Sbjct: 3 GGRWAAAGALLALAAGLLAAGSASEYDYVSFQS 35
>NFKB2_HUMAN (Q00653) Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor| KBF2) (H2TF1) (Lymphocyte translocation chromosome 10) (Oncogene Lyt-10) (Lyt10) [Contains: Nuclear factor NF-kappa-B p52 subunit] Length = 899 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 114 GGAHKVGGDEEAAAKWRVEGGDGDVGFF 31 GG+H GG AA + GG G +GFF Sbjct: 352 GGSHMGGGSGGAAGGYGGAGGGGSLGFF 379
>PXK_RAT (Q4FZZ1) PX domain-containing protein kinase-like protein| (Modulator of Na,K-ATPase) (MONaKA) Length = 580 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 NPTSPSPPSTLHFAAASSSPPTLCAPP 115 +P+SP+PPST ++A PP PP Sbjct: 499 SPSSPTPPSTAGLSSALPPPPPPPPPP 525
>PXK_MOUSE (Q8BX57) PX domain-containing protein kinase-like protein| (Modulator of Na,K-ATPase) (MONaKA) Length = 582 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 NPTSPSPPSTLHFAAASSSPPTLCAPP 115 +P+SP+PPST ++A PP PP Sbjct: 499 SPSSPTPPSTAGLSSALPPPPPPPPPP 525
>SF3B2_HUMAN (Q13435) Splicing factor 3B subunit 2 (Spliceosome-associated| protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) Length = 872 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 17 LIPLQKNPTSPSPPSTLHFAAASSSPPTLCAPP 115 L PLQ P P PP L + PP L PP Sbjct: 76 LPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPP 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,445,379 Number of Sequences: 219361 Number of extensions: 583117 Number of successful extensions: 3517 Number of sequences better than 10.0: 133 Number of HSP's better than 10.0 without gapping: 3069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3488 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
