Clone Name | bastl46d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EPIPL_HUMAN (P58107) Epiplakin (450 kDa epidermal antigen) | 29 | 4.1 | 2 | POLN_HEVBU (P29324) Non-structural polyprotein (EC 2.7.7.48) (RN... | 28 | 7.1 | 3 | CXA3_SHEEP (Q9TU17) Gap junction alpha-3 protein (Connexin-44) (... | 28 | 7.1 | 4 | CKLF2_HUMAN (Q8TAZ6) CKLF-like MARVEL transmembrane domain-conta... | 28 | 9.2 |
---|
>EPIPL_HUMAN (P58107) Epiplakin (450 kDa epidermal antigen)| Length = 5065 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 188 EVQVLHRLPLHRAAEPSRAERICQHRLRS-PGGRSVGRWWDLISLC 54 E LH LPL +A E Q L++ PG + WDL+S C Sbjct: 1081 ETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKDGTSLWDLLSSC 1126
>POLN_HEVBU (P29324) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 69 IPPPTDRPAAGRSEPVLADPLRSARLGG-AMEWETVQH 179 +PPP P+ S P LA+P A G A+ +T +H Sbjct: 740 LPPPAPDPSPPPSAPALAEPASGATAGAPAITHQTARH 777
>CXA3_SHEEP (Q9TU17) Gap junction alpha-3 protein (Connexin-44) (Cx44)| Length = 412 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 18 HLLVSSPGEERRAERDQIPPPTDRPAAGRSEPV-LADPLRSARLGGAM 158 H+L EE+R ER++ PP PA +P + D R+ GA+ Sbjct: 94 HVLHLVRMEEKRKEREEEPPKAAGPAEEHQDPAPVRDDRGKVRIAGAL 141
>CKLF2_HUMAN (Q8TAZ6) CKLF-like MARVEL transmembrane domain-containing protein 2| (Chemokine-like factor superfamily member 2) Length = 248 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 9 AESHLLVSSPGEERRAERDQIPPPTDRPAAGR 104 A+ H+LV PG+E+ ++ + P P P G+ Sbjct: 208 AKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGK 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,051,675 Number of Sequences: 219361 Number of extensions: 690797 Number of successful extensions: 2770 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2769 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)