Clone Name | bastl46c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ITA11_MOUSE (P61622) Integrin alpha-11 precursor | 30 | 4.6 | 2 | CI097_PONPY (Q5RCP1) Protein C9orf97 homolog | 30 | 4.6 | 3 | CI097_HUMAN (Q5T7W7) Protein C9orf97 | 29 | 6.0 | 4 | USPB_PHOLL (P59988) Universal stress protein B | 29 | 7.8 |
---|
>ITA11_MOUSE (P61622) Integrin alpha-11 precursor| Length = 1188 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 11/48 (22%) Frame = +1 Query: 289 GTRLLHLSKFISSQGTFGCDVEHNT-----------VSHVPQKNSGDS 399 G RLL L F + QG C++ N+ +SH PQ+N +S Sbjct: 1016 GNRLLMLRDFFTDQGNTSCNIWGNSTEYRSTPTEEDLSHAPQRNHSNS 1063
>CI097_PONPY (Q5RCP1) Protein C9orf97 homolog| Length = 516 Score = 29.6 bits (65), Expect = 4.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 422 VYCCFSRLESPEFFCGTWDTVLCSTSH 342 +Y C+ LE P++ C W T LC H Sbjct: 172 LYYCYRDLEDPQWIC-AWQTALCQQLH 197
>CI097_HUMAN (Q5T7W7) Protein C9orf97| Length = 516 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 422 VYCCFSRLESPEFFCGTWDTVLCSTSH 342 +Y C+ LE P++ C W T LC H Sbjct: 172 LYYCYHDLEDPQWIC-AWQTALCQHLH 197
>USPB_PHOLL (P59988) Universal stress protein B| Length = 111 Score = 28.9 bits (63), Expect = 7.8 Identities = 10/41 (24%), Positives = 24/41 (58%) Frame = +2 Query: 182 YLEKHEPSILVRKGSTNQEWLLGQSSGGTIFLSTLMGLVYY 304 YL+ H+P +++R ++++L S G + + + L++Y Sbjct: 71 YLDHHDPEVVLRCERLRKQFILTSSLSGLVVICLISMLIWY 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,481,084 Number of Sequences: 219361 Number of extensions: 1256303 Number of successful extensions: 3405 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3404 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)