| Clone Name | bastl46a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PGLRX_COCCA (Q00359) Exopolygalacturonase precursor (EC 3.2.1.67... | 31 | 0.71 | 2 | CJ047_HUMAN (Q86WR7) Protein C10orf47 | 29 | 3.5 | 3 | MOXR_PARDE (P29901) Protein moxR | 29 | 3.5 | 4 | UNC87_CAEEL (P37806) Uncoordinated protein 87 (Protein unc-87) | 28 | 4.6 | 5 | SKB1_MOUSE (Q8CIG8) Protein arginine N-methyltransferase 5 (EC 2... | 28 | 6.0 | 6 | PRP5_NEUCR (Q7SH33) Pre-mRNA-processing ATP-dependent RNA helica... | 28 | 6.0 | 7 | SYM1_DEBHA (Q6BMY0) Protein SYM1 | 28 | 6.0 |
|---|
>PGLRX_COCCA (Q00359) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Galacturan 1,4-alpha-galacturonidase) (Poly(1,4-alpha-D-galacturonide)galacturonohydrolase) Length = 446 Score = 31.2 bits (69), Expect = 0.71 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -1 Query: 219 PPTDLLCGN**ASPG-RLRVSLVELLSGGEDDPVNFFRSIEMCRGLAAASAPRAWRF 52 PP L G + PG R + +++ L GG+DD N +++ C P+ +F Sbjct: 36 PPVPFLPGKASSVPGSRNKTCMLKALGGGKDDSANILSAVKQCNNGGHVVFPKGQQF 92
>CJ047_HUMAN (Q86WR7) Protein C10orf47| Length = 435 Score = 28.9 bits (63), Expect = 3.5 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = +1 Query: 1 SPSCSRRRSREGVLEAAKSPGARCRGRGEAPAHFYRPKKVNWVIFPSRKQFNKAYPKSPR 180 SP+ R R G + G R G P+H +PK FPS + PR Sbjct: 212 SPTSPFREGRPGEWRTPAARGPRSGDPGPGPSHPAQPKAPR---FPSNIIVTNGAAREPR 268 Query: 181 TGLSVPAEKV-GRRSSFIWTKH 243 LS A V RR+ + T H Sbjct: 269 RTLSRAAVSVQERRAQVLATIH 290
>MOXR_PARDE (P29901) Protein moxR| Length = 339 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -1 Query: 216 PTDLLCGN**ASPGRLRVSLVELLSGGEDDPVNFFRSIEMCR 91 PTDL+ A GR R+ +L GED V FF I R Sbjct: 79 PTDLIYSTHIAEDGRPRIEPGPVLEQGEDMAVFFFNEINRAR 120
>UNC87_CAEEL (P37806) Uncoordinated protein 87 (Protein unc-87)| Length = 576 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 82 GEAPAHFYRPKKVNWVIFPSRKQFNKAYPKSPRTGLSVPAEKVGRRSSFIW 234 GE P Y KV+ I PS+ +NK + T P + G+ IW Sbjct: 514 GELP---YEAMKVSETIIPSQAGWNKGDSQKKMTSFGAPRDVKGKHLKRIW 561
>SKB1_MOUSE (Q8CIG8) Protein arginine N-methyltransferase 5 (EC 2.1.1.-) (Shk1| kinase-binding protein 1 homolog) (SKB1 homolog) (Jak-binding protein 1) Length = 636 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 194 FPQRRSVGGHHLYGQNIC--FWSCSGE*KSW 280 FP ++ + H GQNIC FW CS K W Sbjct: 583 FPIKQPITVHE--GQNICVRFWRCSNSKKVW 611
>PRP5_NEUCR (Q7SH33) Pre-mRNA-processing ATP-dependent RNA helicase prp-5 (EC| 3.6.1.-) Length = 1194 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +1 Query: 16 RRRSREGVLEAAKSPGARCRGRGEAPAHFYRPKK 117 RRRSR+ L+ +SP R R R P YRP++ Sbjct: 91 RRRSRDRGLDRLRSPDRR-RDRSRDPDREYRPRR 123
>SYM1_DEBHA (Q6BMY0) Protein SYM1| Length = 206 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 79 RGEAPAHFYRPKKVNWVIFPSRKQFNKA 162 R + AH++ K NWV++P+ + FN A Sbjct: 132 REKLHAHWFNTLKTNWVVWPTFQLFNFA 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,448,078 Number of Sequences: 219361 Number of extensions: 843134 Number of successful extensions: 2145 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2145 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)