Clone Name | bastl46a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SOX13_MOUSE (Q04891) SOX-13 protein | 29 | 5.3 | 2 | AAAS_MOUSE (P58742) Aladin (Adracalin) | 28 | 6.9 | 3 | AAAS_HUMAN (Q9NRG9) Aladin (Adracalin) | 28 | 6.9 |
---|
>SOX13_MOUSE (Q04891) SOX-13 protein| Length = 985 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 188 ATSAADAVTTCCPPGDQATEQKAGEPEP 105 A ++ DA T PP D A+ + +G PEP Sbjct: 34 APASQDAATAKAPPQDCASPESSGSPEP 61
>AAAS_MOUSE (P58742) Aladin (Adracalin)| Length = 546 Score = 28.5 bits (62), Expect = 6.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 112 GSPAFCSVAWSPGGQHVVTASAADVAILIHD 204 G S+AW+P G +++AS D IL+ D Sbjct: 243 GHTPVTSLAWAPNGGWLLSASPVDAVILVWD 273
>AAAS_HUMAN (Q9NRG9) Aladin (Adracalin)| Length = 546 Score = 28.5 bits (62), Expect = 6.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 112 GSPAFCSVAWSPGGQHVVTASAADVAILIHD 204 G S+AW+P G +++AS D AI + D Sbjct: 243 GHTPVTSLAWAPSGGRLLSASPVDAAIRVWD 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,452,069 Number of Sequences: 219361 Number of extensions: 582479 Number of successful extensions: 2312 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2312 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)