Clone Name | bastl45h09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleo... | 32 | 0.40 | 2 | DNLI_THEAC (Q9HJ26) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleo... | 28 | 7.6 | 3 | SNX4_CRYNE (Q5KJJ8) Sorting nexin-4 (Autophagy-related protein 24) | 27 | 9.9 |
---|
>DNLI_THEVO (Q979A1) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 588 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 178 ERGCDTRTPDSRADAANWSTGGRVWSWGGLARVWTRWRWDT 56 E GC+ S AD + + G R W W L R + WDT Sbjct: 396 EDGCEGLVAKSMADDSYYKAGARGWLWIKLKRDYQAQLWDT 436
>DNLI_THEAC (Q9HJ26) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 588 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -2 Query: 178 ERGCDTRTPDSRADAANWSTGGRVWSWGGLARVWTRWRWDT 56 E GC+ S + + + G R W W L R + WDT Sbjct: 396 EDGCEGLVAKSTSPDSFYKAGARGWLWIKLKRDYQAQLWDT 436
>SNX4_CRYNE (Q5KJJ8) Sorting nexin-4 (Autophagy-related protein 24)| Length = 493 Score = 27.3 bits (59), Expect = 9.9 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = -1 Query: 194 TVAESGARVRHADARFASRRSELEHWR*GLE-----LGRAS*GLDAMAMGY 57 T + +RVR DARF ELE + GL +GR +D +A Y Sbjct: 235 TFINAFSRVRKPDARFVEMTEELERFEEGLTGVERVVGRGKSRVDDLAADY 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,566,505 Number of Sequences: 219361 Number of extensions: 279370 Number of successful extensions: 822 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)