Clone Name | bastl45f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-assoc... | 31 | 1.1 | 2 | BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-assoc... | 31 | 1.1 |
---|
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2157 Score = 30.8 bits (68), Expect = 1.1 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +1 Query: 7 LCPPFLLAPPSQTPSKTLAAGAPFRVQTREALGVRRGRGEG 129 L PP APPS P++ A G RV T + RRGRG G Sbjct: 1137 LAPPPPGAPPSPAPARFTARGG--RVFTPRGVPSRRGRGGG 1175
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 30.8 bits (68), Expect = 1.1 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +1 Query: 7 LCPPFLLAPPSQTPSKTLAAGAPFRVQTREALGVRRGRGEG 129 L PP APPS P++ A G RV T + RRGRG G Sbjct: 1140 LAPPPPGAPPSPAPARFTARGG--RVFTPRGVPSRRGRGGG 1178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,087,874 Number of Sequences: 219361 Number of extensions: 128674 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)