Clone Name | bastl45e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CU57_ARADI (P80519) Adult-specific rigid cuticular protein 15.7 ... | 28 | 7.5 | 2 | TONB_PSEAE (Q51368) Protein tonB | 27 | 9.8 | 3 | RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats prote... | 27 | 9.8 |
---|
>CU57_ARADI (P80519) Adult-specific rigid cuticular protein 15.7 (ACP 15.7)| Length = 159 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 156 YRRAAVPLAPAVGARVAGRPPAPEGAHV 239 Y P+APAV A V PA GAH+ Sbjct: 102 YAPPVAPVAPAVAAPVVAAAPALAGAHL 129
>TONB_PSEAE (Q51368) Protein tonB| Length = 342 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 165 AAVPLAPAVGARVAGRPPAPEGAHVPRGV 251 AA P AP VG G AP G+ P G+ Sbjct: 216 AAPPPAPTVGQSTPGAQTAPSGSQGPAGL 244
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 2 LILHTPFFRSTDHPPSLPLPHPRVRQWRRP 91 LI TP T HPP LP PHP ++ P Sbjct: 798 LIQQTP----TLHPPRLPSPHPPLQPMTAP 823 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,078,852 Number of Sequences: 219361 Number of extensions: 363653 Number of successful extensions: 1451 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1450 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)