| Clone Name | bastl45e07 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 122 bits (306), Expect = 4e-28 Identities = 54/83 (65%), Positives = 66/83 (79%) Frame = +2 Query: 197 GTSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFW 376 G++ +T V++D RA+ IDG RR+L+SG IHYPRST DMWP L+ KAKDGGLD +ETYVFW Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSDMWPDLISKAKDGGLDTIETYVFW 79 Query: 377 DVHEPVRXQYDFEGRNDLXRFVK 445 + HEP R QYDF G DL RF+K Sbjct: 80 NAHEPSRRQYDFSGNLDLVRFIK 102
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 120 bits (302), Expect = 1e-27 Identities = 52/81 (64%), Positives = 67/81 (82%) Frame = +2 Query: 203 SAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDV 382 + +VTYDH++++I+G RR+L+SG IHYPRSTP+MWP L+QKAKDGGLDV++TYVFW+ Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG 81 Query: 383 HEPVRXQYDFEGRNDLXRFVK 445 HEP QY F GR DL RF+K Sbjct: 82 HEPSPGQYYFGGRYDLVRFLK 102
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 119 bits (298), Expect = 3e-27 Identities = 50/82 (60%), Positives = 69/82 (84%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWD 379 ++A+ +V+YDH+A++I+G +R+L+SG IHYPRSTP+MWP L+QKAKDGGLDV++TYVFW+ Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN 79 Query: 380 VHEPVRXQYDFEGRNDLXRFVK 445 HEP Y FE R DL +F+K Sbjct: 80 GHEPSPGNYYFEERYDLVKFIK 101
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 114 bits (286), Expect = 9e-26 Identities = 46/77 (59%), Positives = 66/77 (85%) Frame = +2 Query: 215 NVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDVHEPV 394 +V+YDH+A++++G R++L+SG IHYPRSTP+MWP L+QKAK+GG+DV++TYVFW+ HEP Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEPE 82 Query: 395 RXQYDFEGRNDLXRFVK 445 +Y FE R DL +F+K Sbjct: 83 EGKYYFEERYDLVKFIK 99
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 108 bits (271), Expect = 5e-24 Identities = 47/77 (61%), Positives = 62/77 (80%) Frame = +2 Query: 215 NVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDVHEPV 394 NV YD+RA+ I+ RR+L+SG IHYPRSTP+MWP +++KAKD LDV++TYVFW+ HEP Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPEMWPDIIEKAKDSQLDVIQTYVFWNGHEPS 89 Query: 395 RXQYDFEGRNDLXRFVK 445 +Y FEGR DL +F+K Sbjct: 90 EGKYYFEGRYDLVKFIK 106
>BGAL_XANMN (P48982) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 598 Score = 68.6 bits (166), Expect = 7e-12 Identities = 34/70 (48%), Positives = 44/70 (62%) Frame = +2 Query: 242 VIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDVHEPVRXQYDFEGR 421 V DG L+SG IH+ R W +QKA+ GL+ VETYVFW++ EP + Q+DF G Sbjct: 38 VRDGKPYQLLSGAIHFQRIPRAYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGN 97 Query: 422 NDLXRFVKAA 451 ND+ FVK A Sbjct: 98 NDVAAFVKEA 107
>BGAL_CANFA (Q9TRY9) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 668 Score = 63.2 bits (152), Expect = 3e-10 Identities = 30/78 (38%), Positives = 40/78 (51%) Frame = +2 Query: 218 VTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDVHEPVR 397 + Y H + DG +SG IHY R W + K K GL+ ++TYV W+ HEP Sbjct: 35 IDYSHNRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQP 94 Query: 398 XQYDFEGRNDLXRFVKAA 451 QY F G D+ F+K A Sbjct: 95 GQYQFSGEQDVEYFIKLA 112
>BGAL_FELCA (O19015) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 669 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/78 (38%), Positives = 41/78 (52%) Frame = +2 Query: 218 VTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWDVHEPVR 397 + Y H + DG +SG IHY R W + K K GL+ ++TYV W+ HEP Sbjct: 35 IDYGHNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQP 94 Query: 398 XQYDFEGRNDLXRFVKAA 451 QY F G +D+ F+K A Sbjct: 95 GQYQFSGEHDVEYFLKLA 112
>BGAL_MOUSE (P23780) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 647 Score = 55.1 bits (131), Expect = 8e-08 Identities = 28/84 (33%), Positives = 40/84 (47%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWD 379 T + Y + DG +SG IHY R W + K K GL+ ++ YV W+ Sbjct: 29 TQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRLLKMKMAGLNAIQMYVPWN 88 Query: 380 VHEPVRXQYDFEGRNDLXRFVKAA 451 HEP QY+F G D+ F++ A Sbjct: 89 FHEPQPGQYEFSGDRDVEHFIQLA 112
>BGAL_HUMAN (P16278) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 677 Score = 54.7 bits (130), Expect = 1e-07 Identities = 28/84 (33%), Positives = 41/84 (48%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWD 379 T + Y + + DG +SG IHY R W + K K GL+ ++TYV W+ Sbjct: 28 TQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWN 87 Query: 380 VHEPVRXQYDFEGRNDLXRFVKAA 451 HEP QY F +D+ F++ A Sbjct: 88 FHEPWPGQYQFSEDHDVEYFLRLA 111
>BGAL_MACFA (Q60HF6) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 682 Score = 54.3 bits (129), Expect = 1e-07 Identities = 28/84 (33%), Positives = 40/84 (47%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVETYVFWD 379 T + Y + DG +SG IHY R W + K K GL+ ++TYV W+ Sbjct: 28 TRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNTIQTYVPWN 87 Query: 380 VHEPVRXQYDFEGRNDLXRFVKAA 451 HEP QY F +D+ F++ A Sbjct: 88 FHEPWPGQYQFSEDHDVEYFLRLA 111
>ATIN_BHV1P (P30020) Alpha trans-inducing protein (Alpha-TIF)| Length = 504 Score = 33.1 bits (74), Expect = 0.33 Identities = 20/49 (40%), Positives = 25/49 (51%) Frame = +1 Query: 301 PRHVAGADAEGQGRRPGRGRDVRLLGRPRARPXTVRLRGQE*PXEVRQG 447 PRH +G+ A QGRRPGR + + R+ P RG P VR G Sbjct: 407 PRHTSGSGAFSQGRRPGRVCRLGWACKARSGPA----RGGPGPSPVRSG 451
>BGAM_HUMAN (P16279) Beta-galactosidase-related protein precursor| (Beta-galactosidase-like protein) (S-Gal) (Elastin-binding protein) (EBP) Length = 546 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGFIHYPRSTPDMWPGLMQKAKDGGLDVVET 364 T + Y + + DG +SG IHY R W + K K GL+ ++T Sbjct: 28 TQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQT 82
>PT1_CHLPN (Q9Z9E3) Phosphoenolpyruvate-protein phosphotransferase (EC| 2.7.3.9) (Phosphotransferase system, enzyme I) Length = 571 Score = 29.3 bits (64), Expect = 4.7 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Frame = -1 Query: 448 GLDEPXQVIPA-LEVVLSPDGLVDVPEDVRLD-----HVQAAVLGLLHQPRPHVGGAPRV 287 GL E ++ A LE++ P +V +R D +V ++V+G + + V G P V Sbjct: 78 GLQEVSSILQAHLEIMKDPLLTEEVVNTIRKDRKNAEYVFSSVMGKIEESLTAVRGMPSV 137 Query: 286 VDEAGDEH 263 VD D H Sbjct: 138 VDRVQDIH 145
>Y796_METKA (Q8TX79) UPF0288 protein MK0796| Length = 511 Score = 29.3 bits (64), Expect = 4.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 376 PEDVRLDHVQAAVLGLLHQPRPHVG 302 PE+ D V+A VLG+ +Q +PH G Sbjct: 431 PENNPKDRVEAGVLGVTNQAKPHAG 455
>ATCL_SYNP7 (P37278) Cation-transporting ATPase pacL (EC 3.6.3.-)| Length = 926 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 397 PDGLVDVPEDVRLDHVQAAVLGLLHQPRPHVGGAPRVVDEAG 272 P + DV ED D ++G + PRP V A + +AG Sbjct: 539 PSAIADVDEDAETDLTWLGLMGQIDAPRPEVREAVQRCRQAG 580
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 28.5 bits (62), Expect = 8.1 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 8 SSPSLHSTSTALLARLVHRTPSSHEQGAVLVAVSSQESDKAMAAVGR 148 SS HS + A LA H++PS L+ S E+DKA R Sbjct: 716 SSVIKHSNAIACLANSNHQSPSQPVASPSLIKDSKPEADKASKLASR 762 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,245,825 Number of Sequences: 219361 Number of extensions: 794393 Number of successful extensions: 2855 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2855 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)