Clone Name | bastl45c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (... | 56 | 4e-08 | 2 | BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (... | 55 | 8e-08 | 3 | BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (... | 53 | 3e-07 | 4 | BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (... | 52 | 5e-07 | 5 | BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.... | 49 | 6e-06 |
---|
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 56.2 bits (134), Expect = 4e-08 Identities = 21/36 (58%), Positives = 34/36 (94%) Frame = +1 Query: 346 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 453 ++A+ +V+YDH+A++I+G +R+L+SGSIHYPRSTP+ Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPE 55
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 55.1 bits (131), Expect = 8e-08 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +1 Query: 349 SAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 453 + +VTYDH++++I+G RR+L+SGSIHYPRSTP+ Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPE 56
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 53.1 bits (126), Expect = 3e-07 Identities = 19/31 (61%), Positives = 30/31 (96%) Frame = +1 Query: 361 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 453 +V+YDH+A++++G R++L+SGSIHYPRSTP+ Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPE 53
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 52.4 bits (124), Expect = 5e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +1 Query: 343 GTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 453 G++ +T V++D RA+ IDG RR+L+SGSIHYPRST D Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSD 56
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +1 Query: 361 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPD 453 NV YD+RA+ I+ RR+L+SGSIHYPRSTP+ Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPE 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.129 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,594,859 Number of Sequences: 219361 Number of extensions: 393010 Number of successful extensions: 1165 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1165 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)