| Clone Name | bastl45b11 |
|---|---|
| Clone Library Name | barley_pub |
>KE4_CANFA (Q5TJF6) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 360 AKIYLLNEDQEKRSHFPLSRPQHASSHSSE 271 A ++L+ E SH PL +P H SHS + Sbjct: 184 AFLHLIPHALEPHSHHPLEQPGHGHSHSGQ 213
>YC9F_SCHPO (Q09889) Hypothetical protein C584.15c in chromosome III| Length = 594 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = -1 Query: 392 INGVILLNDMSPKYIS*TKIKRSDHTFLC----QDHNTPPPTLLSVVNCLLNFAYVFLMP 225 ++G+++L+ SP + K++ S +F+C H +P + V +L+ ++ FL P Sbjct: 41 LSGIVVLSVSSPIRVKNIKLRLSGRSFVCWADESRHASPGNRIRRQVVQILDKSWSFLAP 100 Query: 224 VSEADLI 204 A +I Sbjct: 101 NESAKVI 107
>ENGD_BUCBP (Q89AR6) GTP-dependent nucleic acid-binding protein engD| Length = 362 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +3 Query: 228 HQKYIGK----VKQAVYHTQKSGRRRVVVLTEESVIASLDLR 341 H K + K +K+ VYH +KS R + LTEE + LR Sbjct: 153 HNKQVNKELLILKKCVYHLEKSKSLRSLNLTEEEIFVINYLR 194
>NADA_CHLTE (Q8KEW2) Quinolinate synthetase A| Length = 322 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 237 YIGKVKQAVYHTQKSGRRRVVVLTEESVIASLDLRS-GDIF 356 ++G + +T+KS R+ +V TE ++ ++ RS G +F Sbjct: 224 FVGSTSALLDYTEKSPRKSFIVATEPGILYEMEKRSPGKVF 264
>G3OX4_ARATH (Q9C971) Gibberellin 3-beta-dioxygenase 4 (EC 1.14.11.15)| (Gibberellin 3 beta-hydroxylase 4) (GA 3-oxidase 4) (AtGA3ox4) (AtGA3ox3) Length = 355 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 228 HQKYIGKVKQAVYHTQKSGRRRVVVLTEESVIASLDLRSGDIFWRHVIEKN 380 H KY G +++ V +K R + ++ SL + DI W H +EK+ Sbjct: 153 HTKYCGIIQEYVDEMEKLASRLLYC-----ILGSLGVTVEDIEWAHKLEKS 198
>KLP2_SCHPO (Q9US03) Kinesin-like protein 2| Length = 817 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 216 LADWHQKYIGKVKQAVYHTQKSGRRRVVVLTEE 314 LA +++ GK K +YH K+GR + +T E Sbjct: 619 LASGNEEEKGKKKLEIYHDTKAGRTTITNITSE 651 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,815,136 Number of Sequences: 219361 Number of extensions: 607190 Number of successful extensions: 1606 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1606 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)