Clone Name | bastl45a12 |
---|---|
Clone Library Name | barley_pub |
>PLB1_CANAL (Q9UWF6) Lysophospholipase 1 precursor (EC 3.1.1.5) (Phospholipase| B 1) (CaPLB1) Length = 605 Score = 31.2 bits (69), Expect = 1.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 186 AILRRKLGWEGEERTEPCRRCYPGRCF 106 AI+RR+ +G E+TE C+RC+ C+ Sbjct: 534 AIIRREQERQGIEQTEQCKRCFENYCW 560
>SALL2_HUMAN (Q9Y467) Sal-like protein 2 (Zinc finger protein SALL2) (HSal2)| Length = 1007 Score = 30.8 bits (68), Expect = 1.4 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 216 LCLQVYTCPQAILRRKLGWEGEERTEPCRRCYPGRCF 106 +CL+V +CP+A LR G G ER C+ C GR F Sbjct: 635 ICLRVLSCPRA-LRLHYGQHGGERPFKCKVC--GRAF 668
>SALL2_MOUSE (Q9QX96) Sal-like protein 2 (Spalt-like protein 2) (MSal-2)| Length = 1004 Score = 30.8 bits (68), Expect = 1.4 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 216 LCLQVYTCPQAILRRKLGWEGEERTEPCRRCYPGRCF 106 +CL+V +CP+A LR G G ER C+ C GR F Sbjct: 633 ICLRVLSCPRA-LRLHYGQHGGERPFKCKVC--GRAF 666
>SUVH1_ARATH (Q9FF80) Histone-lysine N-methyltransferase, H3 lysine-9 specific| SUVH1 (EC 2.1.1.43) (Histone H3-K9 methyltransferase 1) (H3-K9-HMTase 1) (Suppressor of variegation 3-9 homolog protein 1) (Su(var)3-9 homolog protein 1) (Protein SET DOMAIN GR Length = 670 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 311 DYAAVLDAKPLRTLTPMFPA 370 D VLD KPLRTL P+FP+ Sbjct: 10 DKTRVLDIKPLRTLRPVFPS 29
>SUVH3_ARATH (Q9C5P4) Histone-lysine N-methyltransferase, H3 lysine-9 specific| SUVH3 (EC 2.1.1.43) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Suppressor of variegation 3-9 homolog protein 3) (Su(var)3-9 homolog protein 3) (Protein SET DOMAIN GR Length = 669 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 311 DYAAVLDAKPLRTLTPMFP 367 D + VLD KPLR+L P+FP Sbjct: 17 DKSIVLDIKPLRSLKPVFP 35
>YT31_CAEEL (Q10958) Hypothetical protein B0353.1| Length = 182 Score = 28.9 bits (63), Expect = 5.3 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = +2 Query: 140 SVLSSPSQPSFLRSMACGQV*TCRQRDKEIADISPYLRKISCQLTMAGNQQPASVVLDYA 319 S L S P RS + G RQ+ +E + SP+L S + + P +Y Sbjct: 13 SFLPQDSGPMLHRSPS-GAKRKIRQKREEASRPSPFLSPSSSSSQTSISPTPTETSSNYR 71 Query: 320 AVLDAKPLRTLTPMFPAPLGMHTFTPKAHPQLSV 421 +++D+ +++ P F +F P P+LSV Sbjct: 72 SLVDSGDYQSILPDFDP-----SFVPVPTPRLSV 100
>TRIM3_RAT (O70277) Tripartite motif protein 3 (RING finger protein 22)| (Brain-expressed RING finger protein) Length = 744 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = -1 Query: 219 SLCLQVYTCPQAILRRKLGWEGEERTEPCRRCYPGRCFRRPLPPSSKGIAPP 64 S+CL Y CP+ + PC + RC + +PP S ++ P Sbjct: 23 SICLDRYRCPKVL--------------PCLHTFCERCLQNYIPPQSLTLSCP 60
>TRIM3_MOUSE (Q9R1R2) Tripartite motif protein 3 (RING finger protein 22) (RING| finger protein HAC1) Length = 744 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = -1 Query: 219 SLCLQVYTCPQAILRRKLGWEGEERTEPCRRCYPGRCFRRPLPPSSKGIAPP 64 S+CL Y CP+ + PC + RC + +PP S ++ P Sbjct: 23 SICLDRYRCPKVL--------------PCLHTFCERCLQNYIPPQSLTLSCP 60
>HSLO_YERPE (Q8ZJG8) 33 kDa chaperonin (Heat shock protein 33 homolog) (HSP33)| Length = 293 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -3 Query: 247 IRTYVSNFFVS---LPTGLHLSTGHTSEKAWLGG 155 I + N+F+ LPT L + TGH ++KA GG Sbjct: 137 IAACLENYFMQSEQLPTRLFIRTGHVADKAAAGG 170
>PLB2_CANAL (O93795) Lysophospholipase 2 precursor (EC 3.1.1.5) (Phospholipase| B 2) (CaPLB2) Length = 608 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 186 AILRRKLGWEGEERTEPCRRCYPGRCF 106 AI+RR+ G E+TE C++C+ C+ Sbjct: 533 AIIRREQERLGIEQTEQCKKCFENYCW 559
>ATR_XENLA (Q9DE14) Serine/threonine-protein kinase atr (EC 2.7.11.1) (Ataxia| telangiectasia and Rad3-related protein) (Xatr) Length = 2654 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 326 LDAKPLRTLTPMFPAPLGMHT 388 L AKPLR TP PAP+ M T Sbjct: 446 LTAKPLRRNTPSVPAPVDMKT 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,153,531 Number of Sequences: 219361 Number of extensions: 989591 Number of successful extensions: 2752 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2750 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)