| Clone Name | bastl45a03 |
|---|---|
| Clone Library Name | barley_pub |
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 177 KSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAPS 290 K+E +P P LP +PK TP P P L PT P+ Sbjct: 504 KAEPAAPPVTPPAPALPPVVPKETPTP-PALPPTPTPT 540
>T7L1B_BRARE (Q800Q5) Transcription factor 7-like 1-B (HMG box transcription| factor 3-B) (TCF-3-B) Length = 551 Score = 30.0 bits (66), Expect = 1.4 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +2 Query: 41 LTLRPDR---LSPPFRAIASSSSHRLRTSLKYPPL*IEPLPSFYPLTP 175 LT +P+R LS P + +SSSS + L PPL PLP F LTP Sbjct: 476 LTTKPERFPLLSKPPPSSSSSSSSSSSSGLPTPPLLSRPLP-FALLTP 522
>PCLO_MOUSE (Q9QYX7) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) (Brain-derived HLMN protein) Length = 5038 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +3 Query: 144 SRSHPFILSLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAP 287 S+SHPF S + P P P P PPP P L P T+P Sbjct: 2288 SKSHPFFRSSSLDISAQPPPPPPPP--PPPPPPPPPPPPPPLPPATSP 2333
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 29.6 bits (65), Expect = 1.8 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 16/75 (21%) Frame = +3 Query: 81 PSHRHRLIDSAPRSSILLCKSSRSHPFILSLPKSEAMSPLTA*PRG-------------- 218 P HR R + AP+SS L HP +LS S P T+ PR Sbjct: 734 PVHRARAVSPAPQSSSRLQPPFSPHPTLLS---STPKPPGTSEPRSCSSISTALPQVNED 790 Query: 219 --*LPDELPKRTPPP 257 LP +LP+ + PP Sbjct: 791 LVSLPHQLPEASEPP 805
>ARFRP_RAT (Q63055) ARF-related protein (ARP)| Length = 201 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 124 VSSSVNRAAPILLSSHSQSRKQCLH*PHSREASYRTSCPNGRRR-LIQAC 270 VSS PIL+ ++ Q + CL P + A +C GRR L QAC Sbjct: 119 VSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQAC 168
>ARFRP_MOUSE (Q8BXL7) ARF-related protein 1| Length = 201 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 124 VSSSVNRAAPILLSSHSQSRKQCLH*PHSREASYRTSCPNGRRR-LIQAC 270 VSS PIL+ ++ Q + CL P + A +C GRR L QAC Sbjct: 119 VSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQAC 168
>T2A1_AZOBR (P26919) Type-2 restriction enzyme AbrI (EC 3.1.21.4) (Type II| restriction enzyme AbrI) (Endonuclease AbrI) (R.AbrI) Length = 222 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +3 Query: 81 PSHRHRLIDSAPRSSILLCKSSRSHPFILSLPKSEAMSPLTA*-PRG*LPDELPKRTPPP 257 P R D++P +SSR+HP + S + S ++ PR P P+R PPP Sbjct: 158 PESNQRRADTSPH--FRCSRSSRAHPTYGGMTSSASGSSRSSFTPR---PRSSPRRAPPP 212 Query: 258 NPGLSPT 278 G P+ Sbjct: 213 RQGRIPS 219
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 6/45 (13%) Frame = +3 Query: 174 PKSEAMSPLTA*PRG*LPDE------LPKRTPPPNPGLSPTTAPS 290 P S SP+ A P LP + PKR PPP P ++P T P+ Sbjct: 1078 PPSAQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRP-VAPPTRPA 1121
>CABL2_HUMAN (Q9BTV7) CDK5 and ABL1 enzyme substrate 2 (Interactor with CDK3 2)| (Ik3-2) Length = 478 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +3 Query: 174 PKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAPS 290 P +EA P A P P LP RTP P LSPT P+ Sbjct: 74 PPAEAREP-PAPPPPEPPTGLPARTPAPQGLLSPTQVPT 111
>WHRN_RAT (Q810W9) Whirlin (CASK-interacting protein CIP98)| Length = 920 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 174 PKSEAMSPLTA*PRG*LPDELPK-RTPPPNPGLSPTTAP 287 P E +PL++ + P+ R+PPP PG++PT P Sbjct: 612 PVREDSAPLSSAAHSGIVFSAPRNRSPPPPPGIAPTPTP 650
>SPKC_SYNY3 (P74745) Serine/threonine-protein kinase C (EC 2.7.11.1)| Length = 535 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 156 PFILSLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAPS 290 P S P + ++P+ P P +P+ P P+P +SP +P+ Sbjct: 422 PETTSSPTEDTITPMEPEPSLDEPAPIPEPKPSPSPTISPQPSPT 466
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 225 PDELPKRTPPPNPGLSPTTAPS 290 P +P PPP P +PT APS Sbjct: 166 PKPVPPHGPPPKPAPAPTPAPS 187 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 168 SLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAPS 290 S PK A +P P G PK P P P SP APS Sbjct: 157 SPPKPPAPTPKPVPPHG----PPPKPAPAPTPAPSPKPAPS 193
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 246 TPPPNPGLSPTTAPS 290 TPPP PG PTT PS Sbjct: 1397 TPPPGPGPLPTTVPS 1411
>PO2F2_MOUSE (Q00196) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 462 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = +3 Query: 114 PRSSILLCKSSRSHPFIL------SLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSP 275 P + LL ++ +S P +L LP+ + LT+ PR LP + PK PP+ P Sbjct: 121 PPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQPPKCLEPPSHPEEP 180 Query: 276 T 278 + Sbjct: 181 S 181
>MK07_MOUSE (Q9WVS8) Mitogen-activated protein kinase 7 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 5) (ERK-5) (BMK1 kinase) Length = 806 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +3 Query: 168 SLPKSEAMSPLTA*PRG*LPDELP---KRTPPPNPGLSPTTAPS 290 SL S+++ P + P P+ LP PPP+PGL+P + S Sbjct: 652 SLLASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTS 695
>RXRB_HUMAN (P28702) Retinoic acid receptor RXR-beta (Retinoid X receptor beta)| Length = 533 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = +3 Query: 225 PDELPKRTPPPNPG---LSPTTAPS 290 P+ LP+ PPP+P L P+TAPS Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPS 112
>GFC1_HUMAN (P63117) HERV-F(c)1_Xq21.33 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein] Length = 469 Score = 28.1 bits (61), Expect = 5.4 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +3 Query: 126 ILLCKSSRSHPFILSLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLS-PT-TAP 287 +LL K+S S+ K SPL+ P LP PPP PG S PT TAP Sbjct: 104 VLLAKASPSN-------KEPDSSPLSEPPEALALPPLPAALPPPYPGSSGPTPTAP 152
>PO2F2_HUMAN (P09086) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 478 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +3 Query: 114 PRSSILLCKSSRSHPFIL------SLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSP 275 P + LL ++ +S P +L LP+ + LT+ PR LP + R P+P LS Sbjct: 121 PPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSH 180 Query: 276 TTAP 287 P Sbjct: 181 PQPP 184
>OGFR_HUMAN (Q9NZT2) Opioid growth factor receptor (OGFr) (Zeta-type opioid| receptor) (7-60 protein) Length = 677 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 180 SEAMSPLTA*PRG*LPDELPKRTPPPNP----GLSPTTAPS 290 SE P A P G P E P TP P P G P +PS Sbjct: 599 SETPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPS 639 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 180 SEAMSPLTA*PRG*LPDELPKRTPPPNP----GLSPTTAPS 290 SE P A P G P E P TP P P G P +PS Sbjct: 519 SETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPS 559 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 180 SEAMSPLTA*PRG*LPDELPKRTPPPNP----GLSPTTAPS 290 SE P A P G P E P TP P P G P PS Sbjct: 539 SETPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAETPS 579
>PP1RA_RAT (O55000) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (Phosphatase 1 nuclear targeting subunit) (PNUTS protein) (MHC class I region proline-rich protein CAT53) Length = 872 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 113 CGVDETMTMRWLEREGSGGQASGSG 39 C +DET + LE GSGG G+G Sbjct: 526 CAMDETPYVETLEPGGSGGSPDGAG 550
>FBN2_HUMAN (P35556) Fibrillin-2 precursor| Length = 2911 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 127 SSSVNRAAPILLSSHSQSRKQCLH*PHSREASYRTSCPNG 246 ++ ++ + I L SQS K C + + E SY+ SCP G Sbjct: 2480 TTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRG 2519
>GLAS_DROVI (Q24732) Protein glass| Length = 598 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 128 PPL*IEPLPSFYPLTP 175 PPL I+PLPS +P +P Sbjct: 151 PPLDIDPLPSLFPFSP 166
>SECD_MYCLE (P38387) Protein-export membrane protein secD| Length = 571 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 156 PFILSLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSP 275 P + SLP P P G LP+ P PP +PG P Sbjct: 120 PVLNSLPVQRGQDPKPGSPAGTLPNFAP--MPPDHPGAQP 157
>PP1RA_MOUSE (Q80W00) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) Length = 888 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 113 CGVDETMTMRWLEREGSGGQASGSG 39 C +DET + LE GSGG G+G Sbjct: 526 CAMDETPYVETLEPGGSGGSPDGAG 550
>GLAS_DROME (P13360) Protein glass| Length = 604 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 128 PPL*IEPLPSFYPLTP 175 PPL I+PLPS +P +P Sbjct: 152 PPLDIDPLPSLFPFSP 167
>PP1RA_PANTR (Q7YR38) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) (Protein FB19) Length = 940 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 113 CGVDETMTMRWLEREGSGGQASGSG 39 C +DET + LE GSGG G+G Sbjct: 526 CSMDETPYVETLEPGGSGGSPDGAG 550
>PP1RA_MACMU (Q5TM61) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) Length = 940 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 113 CGVDETMTMRWLEREGSGGQASGSG 39 C +DET + LE GSGG G+G Sbjct: 526 CSMDETPYVETLEPGGSGGSPDGAG 550
>PP1RA_HUMAN (Q96QC0) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (Phosphatase 1 nuclear targeting subunit) (MHC class I region proline-rich protein CAT53) (FB19 protein) (PP1-binding protein of 114 kDa) (p99) Length = 940 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 113 CGVDETMTMRWLEREGSGGQASGSG 39 C +DET + LE GSGG G+G Sbjct: 526 CSMDETPYVETLEPGGSGGSPDGAG 550
>FTSK_CORGL (Q8NP53) DNA translocase ftsK| Length = 921 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 222 LPDELPKRTPPPNPGLSPTTAPS 290 LP P+RTPP P +P AP+ Sbjct: 264 LPKAAPRRTPPLTPPPAPVPAPA 286
>DSG1A_MOUSE (Q61495) Desmoglein-1 alpha precursor (Dsg1-alpha) (Desmoglein-1)| (Desmosomal glycoprotein I) (DG1) (DGI) Length = 1057 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 83 WLEREGSGGQASGSGDIRER 24 W+ SGG +SGSGD R+R Sbjct: 488 WVTGSESGGSSSGSGDDRDR 507
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 225 PDELPKRTPPPNPGLSPTTAPS 290 P P +P P P LSPT PS Sbjct: 63 PTPTPTPSPTPTPALSPTPTPS 84
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 162 ILSLPKSEAMSPLTA*PRG*LPDELPKRTPPPNPGLSPTTAPS 290 ILSL +EA + G LP + + PP + GLSP +AP+ Sbjct: 18 ILSLVAAEATTQYG----GYLPPPVTSQPPPSSIGLSPPSAPT 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,626,345 Number of Sequences: 219361 Number of extensions: 821102 Number of successful extensions: 3622 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 3015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3557 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)