| Clone Name | bastl45a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KRA24_HUMAN (Q9BYR9) Keratin-associated protein 2-4 (Keratin-ass... | 31 | 1.3 | 2 | TBX6_BRARE (P79742) T-box transcription factor TBX6 (T-box prote... | 29 | 5.1 | 3 | CID_DROYA (O77027) Protein cubitus interruptus (Fragment) | 29 | 5.1 | 4 | NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 prec... | 28 | 8.7 |
|---|
>KRA24_HUMAN (Q9BYR9) Keratin-associated protein 2-4 (Keratin-associated protein| 2.4) (High sulfur keratin-associated protein 2.4) Length = 128 Score = 31.2 bits (69), Expect = 1.3 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 41 PTRRPL--PPTMSRIRLCRRSSCFLCPSSFTSPIQRPCFRRSSYIQPKS 181 P RRP+ P + CR +C CPSS T+ + RPC ++ QP S Sbjct: 57 PCRRPVCCDPCSLQEGCCRPITC--CPSSCTAVVCRPCCWATTCCQPVS 103
>TBX6_BRARE (P79742) T-box transcription factor TBX6 (T-box protein 6)| Length = 473 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +2 Query: 32 HRVPTRRPLPPTMSRIRLCRRS---------SCFLCPSSFTSPIQRPCFRRSS 163 H + R PLPP +SR++L + S P T+ + R CFR S+ Sbjct: 368 HDLDVRLPLPPKLSRVQLSESALRNLEMSPLSDCANPRPLTNILNRSCFRAST 420
>CID_DROYA (O77027) Protein cubitus interruptus (Fragment)| Length = 403 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +2 Query: 23 SSLHRVPTRRPLPPTMSRIRLCRRSSCFLCPSSFTSPIQRPCFRRSS 163 S + +PT RP+P SC +SF PI C RRSS Sbjct: 343 SQVSSIPTMRPIP------------SCTTTAASFYDPISPGCSRRSS 377
>NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2319 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 352 HVRRIVSSGHPGPRALPERLPCRSRPC 432 H R I G GPR PC S+PC Sbjct: 1231 HFRCICLPGFTGPRCQTALFPCESQPC 1257 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,692,016 Number of Sequences: 219361 Number of extensions: 634174 Number of successful extensions: 2567 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2566 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)