| Clone Name | bastl44d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NEO1_MOUSE (P97798) Neogenin precursor | 28 | 7.3 | 2 | NEO1_HUMAN (Q92859) Neogenin precursor | 27 | 9.6 |
|---|
>NEO1_MOUSE (P97798) Neogenin precursor| Length = 1493 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/51 (29%), Positives = 19/51 (37%) Frame = -2 Query: 256 PLHAGSPTRRLPSPSACXXXXXXXXXXXXXXDHPRRPAPTGISLGLSVRAN 104 P+ + P L +P HP P P G S+ LS RAN Sbjct: 1279 PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPSSPWPIGTSMSLSDRAN 1329
>NEO1_HUMAN (Q92859) Neogenin precursor| Length = 1461 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/51 (29%), Positives = 19/51 (37%) Frame = -2 Query: 256 PLHAGSPTRRLPSPSACXXXXXXXXXXXXXXDHPRRPAPTGISLGLSVRAN 104 P+ + P L +P HP P P G S+ LS RAN Sbjct: 1248 PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRAN 1298 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,836,359 Number of Sequences: 219361 Number of extensions: 401421 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)