Clone Name | bastl44c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.2... | 43 | 5e-04 | 2 | YDFC_SCHPO (Q10484) Hypothetical protein C17C9.12 in chromosome I | 28 | 9.7 |
---|
>SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.21.-)| (Cucumisin-like serine protease) Length = 757 Score = 42.7 bits (99), Expect = 5e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +1 Query: 394 RATYIVHMAKSAMPAEYADHGEWYGASLRS 483 + TYIVHMAKS MP+ + H WY +SLRS Sbjct: 29 QGTYIVHMAKSQMPSSFDLHSNWYDSSLRS 58
>YDFC_SCHPO (Q10484) Hypothetical protein C17C9.12 in chromosome I| Length = 319 Score = 28.5 bits (62), Expect = 9.7 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +3 Query: 27 PSTLTLNHTETPSPLLVPRTRPTNCPSFAHTLPIMS*SVRLPRLYIYPHVIVVATS 194 PST T HT+ P V +P PS A P + + P Y P + TS Sbjct: 184 PSTATTQHTQLPKTSAVSHQKPHEAPSTAVKAPTATVAENEP--YPKPQSVPTTTS 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,437,687 Number of Sequences: 219361 Number of extensions: 1027510 Number of successful extensions: 3298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3292 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)