| Clone Name | bastl44c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TARA_MOUSE (Q99KW3) TRIO and F-actin-binding protein (Protein Ta... | 30 | 3.3 | 2 | EMIL2_HUMAN (Q9BXX0) EMILIN-2 precursor (Elastin microfibril int... | 29 | 5.7 | 3 | ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing prote... | 29 | 5.7 | 4 | SFPQ_MOUSE (Q8VIJ6) Splicing factor, proline- and glutamine-rich... | 28 | 9.7 |
|---|
>TARA_MOUSE (Q99KW3) TRIO and F-actin-binding protein (Protein Tara)| (Trio-associated repeat on actin) Length = 2014 Score = 29.6 bits (65), Expect = 3.3 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 261 TTAMGRARSQLTGGEIRRNQPERPGLVPSPVCPCT 157 T GRA++ L G Q E P +PSP C T Sbjct: 1296 TQPEGRAKATLANGHRPGQQSESPAQLPSPACTST 1330
>EMIL2_HUMAN (Q9BXX0) EMILIN-2 precursor (Elastin microfibril interface-located| protein 2) (Elastin microfibril interfacer 2) (Protein FOAP-10) Length = 1053 Score = 28.9 bits (63), Expect = 5.7 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 158 VQGQTGEGTRPGRSGWFRRISPPVSWDLARPMAVVAS 268 V GQTG GT PG G+ P S +A P A V S Sbjct: 868 VDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGAPVPS 904
>ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing protein 1B (ARID| domain-containing protein 1B) (Osa homolog 2) (hOsa2) (p250R) (BRG1-binding protein hELD/OSA1) (BRG1-associated factor 250b) (BAF250B) Length = 2236 Score = 28.9 bits (63), Expect = 5.7 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 8/51 (15%) Frame = +3 Query: 111 SLPPSTSSSGLASYPP-------YKDRQERGQGPGAPVGSVG-SRLPSAGI 239 S PP+ S ASY + Q GQGP P G+V R+PSAG+ Sbjct: 841 SRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGM 891
>SFPQ_MOUSE (Q8VIJ6) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) Length = 699 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 117 PPSTSSSGLASYPPYKDRQERGQGPGAPVGSVG 215 PPST SSG+++ PP + G P P G G Sbjct: 160 PPSTPSSGVSTTPP-----QTGGPPPPPAGGAG 187 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,427,800 Number of Sequences: 219361 Number of extensions: 506141 Number of successful extensions: 2585 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2581 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)