| Clone Name | bastl44c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | M3K10_HUMAN (Q02779) Mitogen-activated protein kinase kinase kin... | 31 | 1.0 | 2 | SAMD6_MOUSE (Q6GQX6) Sterile alpha motif domain-containing prote... | 29 | 3.9 | 3 | SAMD6_RAT (P0C0T2) Sterile alpha motif domain-containing protein... | 29 | 5.1 | 4 | P100_HCMVA (P08318) Large structural phosphoprotein (pp150) (150... | 28 | 6.7 |
|---|
>M3K10_HUMAN (Q02779) Mitogen-activated protein kinase kinase kinase 10 (EC| 2.7.11.25) (Mixed lineage kinase 2) (Protein kinase MST) Length = 954 Score = 31.2 bits (69), Expect = 1.0 Identities = 21/53 (39%), Positives = 26/53 (49%) Frame = -1 Query: 417 KATPVAARTSWTGRGSTKTSPKAVISTGPRMPAARSAAVTRGATRQGLASGGS 259 K T A+ T +GS SP A S PR+ A R V G + G +SGGS Sbjct: 483 KITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGS 535
>SAMD6_MOUSE (Q6GQX6) Sterile alpha motif domain-containing protein 6| Length = 883 Score = 29.3 bits (64), Expect = 3.9 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = -1 Query: 420 EKATPVAARTSWTGRGSTKTSPKAVISTGPRMPAARSAAVTRGATRQGLASGGS 259 +K P S T S TSP S P+ A S+ + + RQ +SGGS Sbjct: 712 KKLDPSKRPPSGTSATSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGS 765
>SAMD6_RAT (P0C0T2) Sterile alpha motif domain-containing protein 6| (Polycystic kidney disease protein 1) (SamCystin) Length = 871 Score = 28.9 bits (63), Expect = 5.1 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = -1 Query: 420 EKATPVAARTSWTGRGSTKTSPKAVISTGPRMPAARSAAVTRGATRQGLASGGS 259 +K P S T S TSP S P+ A S+ + + RQ +SGGS Sbjct: 714 KKLDPGKRPPSGTSATSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGS 767
>P100_HCMVA (P08318) Large structural phosphoprotein (pp150) (150 kDa matrix| phosphoprotein) (Basic phosphoprotein) (BPP) (Tegument protein UL32) Length = 1048 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 372 STKTSPKAVISTGPRMPAARSAAVTRGATR 283 +T T+ + +ST PR P+ AAVT+ A+R Sbjct: 663 TTSTASQNTVSTTPRRPSTPRAAVTQTASR 692 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.123 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,264,760 Number of Sequences: 219361 Number of extensions: 351389 Number of successful extensions: 1090 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)