Clone Name | bastl44b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UNC5C_HUMAN (O95185) Netrin receptor UNC5C precursor (Unc-5 homo... | 28 | 5.4 | 2 | NU5M_PETMA (Q35543) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 28 | 7.0 |
---|
>UNC5C_HUMAN (O95185) Netrin receptor UNC5C precursor (Unc-5 homolog C) (Unc-5| homolog 3) Length = 931 Score = 28.1 bits (61), Expect = 5.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 333 PWTRASTCGTRRSRWR 380 PW++ STCGT + WR Sbjct: 321 PWSKWSTCGTECTHWR 336
>NU5M_PETMA (Q35543) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 598 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 288 TYLPGYTHVRTCLATHLSLSLPRNVDRRVVDRTWMEWSG 172 T L Y H+ L +HLSL + + +V+D +W+E G Sbjct: 517 TQLAFYPHIIHRLTSHLSLIWSQKLMTQVMDVSWLEKIG 555 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,267,126 Number of Sequences: 219361 Number of extensions: 594571 Number of successful extensions: 1174 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)