Clone Name | bastl44a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TULP1_MOUSE (Q9Z273) Tubby-related protein 1 (Tubby-like protein 1) | 29 | 3.6 | 2 | THII_THETN (Q8R9F0) Probable thiamine biosynthesis protein thiI | 28 | 6.2 | 3 | THII_OCEIH (Q8EPB3) Probable thiamine biosynthesis protein thiI | 28 | 6.2 |
---|
>TULP1_MOUSE (Q9Z273) Tubby-related protein 1 (Tubby-like protein 1)| Length = 543 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 134 PIAAFAVAKGGVVLKHIFLNGPPTEAARRGPDRDRVEEEAE 256 P A F V +GG K + GPP +G + ++ EEE E Sbjct: 215 PAAMFLVGEGGAAEKGVKKKGPP-----KGSEEEKKEEEEE 250
>THII_THETN (Q8R9F0) Probable thiamine biosynthesis protein thiI| Length = 380 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 113 VEAGAGSPIAAFAVAKGGVVLKHIFLNGPPTEAARRGPDRDRVEEEAED 259 + G SP+AA+ + K GV ++ ++ + PP + DR +E+ D Sbjct: 179 LSGGIDSPVAAWMMMKRGVEVEAVYFHSPPYTS-------DRAKEKVVD 220
>THII_OCEIH (Q8EPB3) Probable thiamine biosynthesis protein thiI| Length = 400 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 113 VEAGAGSPIAAFAVAKGGVVLKHIFLNGPPTEAAR 217 + G SP+A F K GV L+ I + PP + R Sbjct: 183 LSGGIDSPVAGFLAMKRGVQLEAIHFHSPPFTSER 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,953,237 Number of Sequences: 219361 Number of extensions: 251665 Number of successful extensions: 828 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)