| Clone Name | bastl43h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYQ_XYLFT (Q87DU6) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glu... | 27 | 0.11 | 2 | SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glu... | 27 | 0.11 | 3 | ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disint... | 29 | 6.3 | 4 | RS13_THEVO (Q97B96) 30S ribosomal protein S13P | 28 | 8.2 | 5 | SAYP_DROME (Q9VWF2) Supporter of activation of yellow protein (P... | 28 | 8.2 |
|---|
>SYQ_XYLFT (Q87DU6) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 580 Score = 26.9 bits (58), Expect(2) = 0.11 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 285 LPKMAHLEHPIPWHGSPKQPSHPTYLKF 202 LP +HL P+ G P++PS P ++F Sbjct: 256 LPNNSHLLKPLLDKGFPQEPSQPRQIEF 283 Score = 26.6 bits (57), Expect(2) = 0.11 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 428 VTHSLADFDFHDHRP 384 +THSL +F DHRP Sbjct: 231 ITHSLCTLEFEDHRP 245
>SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 580 Score = 26.9 bits (58), Expect(2) = 0.11 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 285 LPKMAHLEHPIPWHGSPKQPSHPTYLKF 202 LP +HL P+ G P++PS P ++F Sbjct: 256 LPNNSHLLKPLLDKGFPQEPSQPRQIEF 283 Score = 26.6 bits (57), Expect(2) = 0.11 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 428 VTHSLADFDFHDHRP 384 +THSL +F DHRP Sbjct: 231 ITHSLCTLEFEDHRP 245
>ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1906 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 328 CPTAR*PRTHKGCWSIKTAGRWSWKSKSAKECVTT 432 C PRTHK C S + SWK+ KEC T Sbjct: 1452 CSHLHKPRTHKACRSGRCP---SWKANKWKECSVT 1483
>RS13_THEVO (Q97B96) 30S ribosomal protein S13P| Length = 171 Score = 28.5 bits (62), Expect = 8.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 302 GMNRKPGYGAQLRANLEPTKGVGRLRQQD 388 G+ + GY R NL+PTK +G L++ + Sbjct: 54 GIGLRLGYAIAERLNLQPTKKIGELKEDE 82
>SAYP_DROME (Q9VWF2) Supporter of activation of yellow protein (Protein enhancer| of yellow 3) Length = 2006 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = +1 Query: 301 RDEPEAGLRCPTAR*PRTHKGCWSI--KTAGR---WSWKSKSAKECV 426 RD PEA +RC T R R H C + + GR ++W+ K C+ Sbjct: 1707 RDMPEAFIRCYTCR-KRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCI 1752 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,071,134 Number of Sequences: 219361 Number of extensions: 1474785 Number of successful extensions: 3418 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3417 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)