Clone Name | bastl43f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INHA_BOVIN (P07994) Inhibin alpha chain precursor | 29 | 6.4 | 2 | ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adreno... | 28 | 8.4 | 3 | ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adre... | 28 | 8.4 |
---|
>INHA_BOVIN (P07994) Inhibin alpha chain precursor| Length = 360 Score = 28.9 bits (63), Expect = 6.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 305 VFLLVVLALRGRGASGLDADGELLMAFRRAVTADPLG 415 + LL++ G G GL+ D EL++A RA+ D LG Sbjct: 5 LLLLLLAPQGGHGCHGLELDRELVLAKVRALFLDALG 41
>ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 515 Score = 28.5 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 217 SFVRSFGCNCNGGQEARRR 273 +F+R GC C GG+ RRR Sbjct: 358 AFMRILGCQCRGGRRRRRR 376
>ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 514 Score = 28.5 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 217 SFVRSFGCNCNGGQEARRR 273 +F+R GC C GG+ RRR Sbjct: 357 AFMRILGCQCRGGRRRRRR 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,272,638 Number of Sequences: 219361 Number of extensions: 561996 Number of successful extensions: 1496 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)