ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl43c06 |
|---|---|
| Clone Library Name | barley_pub |
>YBE1_SCHPO (O42980) Putative thiol protease C17D11.01 (EC 3.4.22.-)| Length = 420 Score = 32.3 bits (72), Expect = 0.34 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 55 HRSHHHRTH---PTAPADFPQIRSLSTAKKLPGSDPIPGEVRQAR 180 H HHH +H P++PA+ Q S ++K+ P P E +Q R Sbjct: 304 HHHHHHHSHDDDPSSPAEKKQNHVPSPSEKIQDHVPSPSEKKQDR 348
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 32.0 bits (71), Expect = 0.44 Identities = 19/59 (32%), Positives = 23/59 (38%) Frame = +1 Query: 1 SHSPSPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPGEVRQA 177 +H S N H P H HHH HP PA P ++ P P P + R A Sbjct: 32 NHHASHGHHNSHHP--QHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGA 88
>MAFB_RAT (P54842) Transcription factor MafB (V-maf musculoaponeurotic| fibrosarcoma oncogene homolog B) (Transcription factor MAF1) Length = 323 Score = 29.6 bits (65), Expect = 2.2 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +1 Query: 4 HSPSPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPG 162 H P A H HHH H +P P + S A++LP S P PG Sbjct: 142 HHGYPGAGVTHDELGPHAHPHHHHHHQASP---PPSSAASPAQQLPTSHPGPG 191
>MAFB_MOUSE (P54841) Transcription factor MafB (V-maf musculoaponeurotic| fibrosarcoma oncogene homolog B) (Transcription factor MAF1) (Segmentation protein KR) (Kreisler) Length = 323 Score = 29.6 bits (65), Expect = 2.2 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +1 Query: 4 HSPSPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPG 162 H P A H HHH H +P P + S A++LP S P PG Sbjct: 142 HHGYPGAGVTHDDLGQHAHPHHHHHHQASP---PPSSAASPAQQLPTSHPGPG 191
>DLX6A_BRARE (Q98877) Homeobox protein Dlx6a (DLX-6) (Distal-less homeobox| protein 6a) Length = 247 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 1 SHSPSPAASNGHIPFITLHR-SHHHRTHPTAP 93 S SP+ + H P LH SHHH H ++P Sbjct: 30 SQQSSPSMAASHYPLHCLHSGSHHHHQHDSSP 61
>MAFB_HUMAN (Q9Y5Q3) Transcription factor MafB (V-maf musculoaponeurotic| fibrosarcoma oncogene homolog B) Length = 323 Score = 29.3 bits (64), Expect = 2.9 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +1 Query: 4 HSPSPAASNGHI---PFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPG 162 H P A H P H HHH+ P P + S A++LP S P PG Sbjct: 142 HHAYPGAGVAHDELGPHAHPHHHHHHQASP------PPSSAASPAQQLPTSHPGPG 191
>CDX2_MESAU (Q04649) Homeobox protein CDX-2 (Caudal-type homeobox protein 2)| Length = 313 Score = 28.9 bits (63), Expect = 3.7 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +1 Query: 13 SPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPGEVRQARSFCP 192 SPAA+ G+ H HH HP PA P S PG P P A P Sbjct: 99 SPAAAMGYSSPADYHAHHHPHHHPHHPAAAPSCASGLLQTLNPG-PPGPAATGAAEQLSP 157
>CDX2_HUMAN (Q99626) Homeobox protein CDX-2 (Caudal-type homeobox protein 2)| (CDX-3) Length = 313 Score = 28.9 bits (63), Expect = 3.7 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +1 Query: 13 SPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPGEVRQARSFCP 192 SPAA+ G+ H HH HP PA P S PG P P A P Sbjct: 100 SPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPG-PPGPAATAAAEQLSP 158
>DHX34_MOUSE (Q9DBV3) Probable ATP-dependent RNA helicase DHX34 (EC 3.6.1.-) (DEAH| box protein 34) Length = 1145 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 34 HIPFITLHRSHHHRTHPTAPADFP 105 H+PF L R H T P AP D P Sbjct: 1078 HMPFTPLERIAHENTCPEAPGDDP 1101
>CDX2_MOUSE (P43241) Homeobox protein CDX-2 (Caudal-type homeobox protein 2)| Length = 311 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 13 SPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRS 117 SPAA+ G+ H HH HP PA P S Sbjct: 99 SPAAAMGYSSPAEYHAHHHPHHHPHHPAASPSCAS 133
>GCM2_DROME (Q9VLA2) Transcription factor glial cells missing 2 (Protein| glide-2) Length = 613 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 6/38 (15%) Frame = +1 Query: 1 SHSPSPAASNGHIP------FITLHRSHHHRTHPTAPA 96 S +P+ AA GH P +T H HHH H A A Sbjct: 567 STAPTVAAPPGHPPPPPPPPTLTYHHHHHHHLHHPAAA 604
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 1 SHSPSPAASNGHIPFITLHRSHHHRTHPTAPADFP 105 +H S N H P H HHH HP PA P Sbjct: 32 NHHASHGHHNSHHPQHH-HHHHHHHHHPPPPAPQP 65
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 27.7 bits (60), Expect = 8.3 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 10/60 (16%) Frame = +1 Query: 4 HSPSPAASN----GHIPFITLHRSHHHRTHPTAPA------DFPQIRSLSTAKKLPGSDP 153 H P+PA + H+P R H HR PT PQ L K L DP Sbjct: 81 HRPTPARDHRDPRDHLPPTRTRRDHQHRPPPTTTTTTIKDPQHPQDPLLLPTKTLQEEDP 140
>MA205_DROME (P23226) 205 kDa microtubule-associated protein| Length = 1185 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 43 FITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGSDPIPGEVRQARSFCP 192 F+ +H + +P A A P + S S++ DP+PG Q R F P Sbjct: 225 FVKNLEENHSQLNPNAVAFVPGVGSQSSSPLPAAEDPLPGV--QPRPFLP 272
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +1 Query: 13 SPAASNGHIPFITLHRSHHHRTHPTAPADFPQIRSLSTAKKLPGS 147 SPA SN +PF LH S A FP R + + KLP + Sbjct: 16 SPAQSNMVVPFAGLHSS----------AAFPVTRKFADSSKLPSN 50
>HXA9_MOUSE (P09631) Homeobox protein Hox-A9 (Hox-1.7)| Length = 271 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 1 SHSPSPAASNGHIPFITLHRSHHHRTHPTAP 93 S +P AA +P H HH HP AP Sbjct: 66 SWNPVHAAGANAVPAAVYHHHHHPYVHPQAP 96
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 1 SHSPSPAASNGHIPFITLHRSHHHRTHPTAPADFP 105 +H S N H P H HHH HP PA P Sbjct: 32 NHHASHGHHNSHHPQHH-HHHHHHHHHPPPPAPQP 65
>COBQ_CHRVO (Q7NXQ0) Cobyric acid synthase| Length = 490 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -3 Query: 216 PSSISTMAGAKAPCLTDLAWDRIRSWKLLGRGK*SNLGEICGRCGMSAVMVRAMESDEG 40 P+ + + G+K L DLAW R + W R G++ G CG ++ + + +G Sbjct: 292 PADLIVLPGSKN-VLADLAWLRAQGWDEALRRHLRYGGKVLGICGGLQMLGKKLHDPDG 349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,988,576 Number of Sequences: 219361 Number of extensions: 478490 Number of successful extensions: 1954 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1941 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
