Clone Name | bastl43b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VG26_BPP22 (P35837) Packaged DNA stabilization protein gp26 | 30 | 1.9 | 2 | DHP2_CAEBR (Q61YQ1) Dihydropyrimidinase 2 (EC 3.5.2.2) | 28 | 4.1 | 3 | Y215_ADE02 (P03291) Hypothetical protein F-215 | 28 | 7.0 |
---|
>VG26_BPP22 (P35837) Packaged DNA stabilization protein gp26| Length = 232 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 345 SFTLLSPNTATVSPSAGGEP-LGARARGWMPWTRTPSK 235 S +L SP T S S GG+ LGAR GW T T +K Sbjct: 147 SQSLASPLNVTTSYSVGGKKVLGARQTGWTAATGTANK 184
>DHP2_CAEBR (Q61YQ1) Dihydropyrimidinase 2 (EC 3.5.2.2)| Length = 518 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/64 (23%), Positives = 30/64 (46%), Gaps = 8/64 (12%) Frame = +2 Query: 170 GTGSELLVYDVDAARLVAS--------FRVFDGVRVHGIQXXXXXXXXXXXXDGLTVAVF 325 G+ ++++V++ +A R ++ F +F+G++VHG+ DG V Sbjct: 391 GSDADIVVWNANATRTISKDTHHHAIDFNIFEGMQVHGVPETTICRGRIVWADGQLRTVQ 450 Query: 326 GERR 337 G R Sbjct: 451 GAGR 454
>Y215_ADE02 (P03291) Hypothetical protein F-215| Length = 215 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = -2 Query: 378 STPAASTRRLRSFTLLS-PNTATVSPSAGGEP---LGARARGWMPWTRTPSKTRKE 223 ST A+ TR + + S P + T SP EP + R R W ++P KT +E Sbjct: 7 STAASGTREASTPSRSSWPASPTTSPPPWSEPDAEISRRKRSSSSWPKSPIKTTQE 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,604,838 Number of Sequences: 219361 Number of extensions: 174514 Number of successful extensions: 826 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)