| Clone Name | bastl43a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RUSC2_MOUSE (Q80U22) RUN and SH3 domain-containing protein 2 | 32 | 0.97 | 2 | FTSK_HAEIN (P45264) DNA translocase ftsK | 29 | 6.3 |
|---|
>RUSC2_MOUSE (Q80U22) RUN and SH3 domain-containing protein 2| Length = 1514 Score = 31.6 bits (70), Expect = 0.97 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +3 Query: 210 ARTACSPPMMTSTAAIARFPFSPTAPPAPRTRLS 311 A T+CSPP TAA + P+S T PP R S Sbjct: 792 ASTSCSPPPEQGTAADSVSPWSHTCPPTVRPATS 825
>FTSK_HAEIN (P45264) DNA translocase ftsK| Length = 529 Score = 28.9 bits (63), Expect = 6.3 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 155 LSLTASFQISTGYFSDSGGADSLFAADDDLYGSYRSFSLF-PHGASRTTDE 304 ++ T + +I + D GGA++L D LY S L HGA + DE Sbjct: 376 IAFTVASKIDSRTILDQGGAEALLGRGDMLYSGQGSSDLIRVHGAYMSDDE 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,107,026 Number of Sequences: 219361 Number of extensions: 497934 Number of successful extensions: 1971 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)