ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl42h10 |
|---|---|
| Clone Library Name | barley_pub |
>TSP4_RAT (P49744) Thrombospondin-4 precursor| Length = 980 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 184 CGPTMASTPPPRDLARLDPAAPPTR 258 CGP +P P L + P APPTR Sbjct: 279 CGPLSFQSPTPNTLVPIAPPAPPTR 303
>TSP4_MOUSE (Q9Z1T2) Thrombospondin-4 precursor| Length = 963 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 184 CGPTMASTPPPRDLARLDPAAPPTR 258 CGP +P P L + P APPTR Sbjct: 263 CGPLSFQSPTPNTLVPIAPPAPPTR 287
>ZDH19_MOUSE (Q810M5) Probable palmitoyltransferase ZDHHC19 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 19) (DHHC-19) Length = 347 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +2 Query: 236 TPPRRPREISPASPSPQ--------KDLAGPGLATALTRRRR 337 +PPRRP+ P P PQ K G G A AL RR Sbjct: 282 SPPRRPKHCRPGPPGPQHQPRRVPGKGPPGSGEAAALQEMRR 323
>SYN1_HUMAN (P17600) Synapsin-1 (Synapsin I) (Brain protein 4.1)| Length = 705 Score = 26.6 bits (57), Expect(2) = 1.6 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +2 Query: 230 ASTPPRRPREISPASPSPQKDLAGPGLATALT 325 A P P PASPSPQ+ AGP AT T Sbjct: 537 AGGPGAPPAARPPASPSPQRQ-AGPPQATRQT 567 Score = 21.9 bits (45), Expect(2) = 1.6 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +1 Query: 187 GPTMASTPPPRDLARLDPAAPP 252 GP + PPP+ L PP Sbjct: 478 GPPLQQRPPPQGQQHLSGLGPP 499
>SYN1_CANFA (O62732) Synapsin-1 (Synapsin I) (Fragment)| Length = 415 Score = 26.6 bits (57), Expect(2) = 1.6 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +2 Query: 230 ASTPPRRPREISPASPSPQKDLAGPGLATALT 325 A P P PASPSPQ+ AGP AT T Sbjct: 265 AGGPGAPPAARPPASPSPQRQ-AGPPQATRQT 295 Score = 21.9 bits (45), Expect(2) = 1.6 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +1 Query: 187 GPTMASTPPPRDLARLDPAAPP 252 GP + PPP+ L PP Sbjct: 206 GPPLQQRPPPQGQQHLSGLGPP 227
>SYN1_RAT (P09951) Synapsin-1 (Synapsin I)| Length = 704 Score = 25.8 bits (55), Expect(2) = 2.6 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 230 ASTPPRRPREISPASPSPQKDLAGPGLAT 316 A P P PASPSPQ+ AGP AT Sbjct: 535 AGGPGAPPAARPPASPSPQRQ-AGPPQAT 562 Score = 21.9 bits (45), Expect(2) = 2.6 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +1 Query: 187 GPTMASTPPPRDLARLDPAAPP 252 GP + PPP+ L PP Sbjct: 476 GPPLQQRPPPQGQQHLSGLGPP 497
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 233 STPPRRPREISPASPSPQKDLA 298 STP PR+ SPASPSP L+ Sbjct: 181 STPIPHPRKRSPASPSPSPSLS 202
>DVL3_HUMAN (Q92997) Segment polarity protein dishevelled homolog DVL-3| (Dishevelled-3) (DSH homolog 3) Length = 716 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 187 GPTMASTPPPRDLARLDPAAPPTRDLA 267 GP M PPP A P APP RDLA Sbjct: 663 GPPMLMMPPP-PAAMGPPGAPPGRDLA 688
>ADA15_MOUSE (O88839) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (AD56) Length = 864 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 239 PPRRPREISPASPSPQKDLAGPG 307 PPR+P +P P DL GPG Sbjct: 818 PPRKPLPANPQGQHPPGDLPGPG 840
>SYN1_MOUSE (O88935) Synapsin-1 (Synapsin I)| Length = 706 Score = 24.3 bits (51), Expect(2) = 7.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 230 ASTPPRRPREISPASPSPQKDLAGP 304 A P P PASPSPQ+ P Sbjct: 537 AGGPGAPPAARPPASPSPQRQAGAP 561 Score = 21.9 bits (45), Expect(2) = 7.0 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +1 Query: 187 GPTMASTPPPRDLARLDPAAPP 252 GP + PPP+ L PP Sbjct: 478 GPPLQQRPPPQGQQHLSGLGPP 499
>ADA15_HUMAN (Q13444) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) Length = 814 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 239 PPRRPREISPASPSPQKDLAGPG 307 PPR+P P P DL GPG Sbjct: 768 PPRKPLPADPQGRCPSGDLPGPG 790
>CSKI1_HUMAN (Q8WXD9) Caskin-1 (CASK-interacting protein 1)| Length = 1431 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 190 PTMASTPPPRDLARLDPAAPP 252 P + PPP DLA L P PP Sbjct: 1194 PPPPAEPPPTDLAHLPPLPPP 1214
>ADA15_RAT (Q9QYV0) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (CRII-7) Length = 816 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 239 PPRRPREISPASPSPQKDLAGPG 307 PPR+P +P P DL GPG Sbjct: 770 PPRKPLPANPQGRPPLGDLPGPG 792 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.132 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,596,360 Number of Sequences: 219361 Number of extensions: 190344 Number of successful extensions: 1140 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
