ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl42h01 |
|---|---|
| Clone Library Name | barley_pub |
>SYNP2_MOUSE (Q91YE8) Synaptopodin-2 (Myopodin)| Length = 1087 Score = 33.1 bits (74), Expect = 0.18 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -1 Query: 249 WNPAAGAVGAGQILATTLTPPSPPDVTASSSIEIRSTAA 133 W+P G A + +T PP+PP VTA SSI+I AA Sbjct: 770 WSP--GVAPAQRPAFSTSNPPNPPQVTAVSSIKIAQPAA 806
>PAKM_DROME (Q9VXE5) Serine/threonine-protein kinase PAK mbt (EC 2.7.11.1)| (p21-activated kinase-related protein) (Protein mushroom bodies tiny) Length = 639 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 243 PAAGAVGAGQILATTLTPPSPPDVTASSSIEIRSTAASSPIEIRLGSSGLNQWR 82 PAAG G G + PP +S + A+ P+ +R + L Q+R Sbjct: 169 PAAGTPGVGGASSGGFKPPGAHPSLLYNSQHAHANGATGPLAVRTDQTNLQQYR 222
>ARR3_ARATH (Q9ZWS9) Two-component response regulator ARR3| Length = 231 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 195 TPPSPPDVTASSSIEIRSTAASSPIEI 115 TPP PP ++A+SS+E + SP+ + Sbjct: 177 TPPPPPPLSATSSMESSDSTVESPLSM 203
>GLI1_HUMAN (P08151) Zinc finger protein GLI1 (Glioma-associated oncogene)| (Oncogene GLI) Length = 1106 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = -1 Query: 240 AAGAVGAGQILATTLTPPSPPDVTASSSIEIRSTAASSPIEIRLGSSGLNQWRIF 76 A G L T++ P PP +T +++++ R + + SGLN + F Sbjct: 670 AGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNPYMDF 724
>PIM2_MOUSE (Q62070) Serine/threonine-protein kinase Pim-2 (EC 2.7.11.1)| Length = 370 Score = 28.9 bits (63), Expect = 3.5 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = -1 Query: 243 PAAGAVGAGQILATTLTPPSPPDVTASSSIEIRSTAASSPIEIRLGSSGLN 91 P+AGA G L +TL PPSP A AS+P + G SGLN Sbjct: 11 PSAGASGPPDSLPSTLAPPSPGSPAA-------LPRASTPCGLS-GFSGLN 53
>YEHM_ECOLI (P33349) Hypothetical protein yehM| Length = 759 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 225 GAGQILATTLTPPSPPDVTASSSIEIRSTAASSPIEIRL 109 G G++ +T PP P DVT E+ TA S P E+ L Sbjct: 361 GFGKLAPSTPQPPLPKDVTC----ELERTAISLPAELTL 395
>NFRKB_HUMAN (Q6P4R8) Nuclear factor related to kappa-B-binding protein| (DNA-binding protein R kappa-B) Length = 1299 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = -1 Query: 240 AAGAVGAGQILATTLTPPSPPDVTASSSIEIRSTAASSPIEIRLGSSGLNQ 88 A+ A G+G + + ++ PS + S ++ + S AAS+PI I G+ + Q Sbjct: 1115 ASVASGSGTVHTSAVSLPSM-NAAVSKTVAVASGAASTPISISTGAPTVRQ 1164
>BAIP2_HUMAN (Q9UQB8) Brain-specific angiogenesis inhibitor 1-associated protein| 2 (BAI1-associated protein 2) (BAI-associated protein 2) (BAP2 protein) (Insulin receptor substrate p53) (IRSp53) (Insulin receptor substrate protein of 53 kDa) (Insulin rece Length = 552 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 68 IYKKILH*FNPELPNLISMGE 130 +YK I+ FNP L N I+MG+ Sbjct: 16 VYKTIMEQFNPSLRNFIAMGK 36
>CNTRB_HUMAN (Q8N137) Centrobin (LYST-interacting protein 8)| Length = 903 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 222 AGQILATTLTPPSPPDVTASSS 157 A Q+L+TTL PP+PP A S Sbjct: 564 ANQLLSTTLPPPNPPAPPAGPS 585
>CUT_DROME (P10180) Homeobox protein cut| Length = 2175 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 225 GAGQILATTLTPPSPPDVTASSSIEIRSTAASS 127 G+ + + L PP PP +SS + ST +SS Sbjct: 2118 GSSEEMPAPLAPPPPPPAASSSIVSGESTTSSS 2150
>YOPN_YEREN (P16945) Outer membrane protein yopN (Yop4b) (LcrE)| Length = 292 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 98 PELPNLISMGEEAAVDLISMEEEAVTSG 181 PEL +L+ + E+A V ++ +EEA+ G Sbjct: 149 PELAHLLHLVEQALVSMVEEQEEAIVLG 176
>BAIP2_CRIGR (Q60437) Brain-specific angiogenesis inhibitor 1-associated protein| 2 (BAI1-associated protein 2) (BAI-associated protein 2) (Insulin receptor substrate p53) (IRSp53) (Insulin receptor substrate protein of 53 kDa) (Insulin receptor tyrosine k Length = 521 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 68 IYKKILH*FNPELPNLISMGE 130 +YK I+ FNP L N I+MG+ Sbjct: 16 VYKTIMEQFNPSLRNFIAMGK 36
>BAIP2_BOVIN (Q5EAD0) Brain-specific angiogenesis inhibitor 1-associated protein| 2 (BAI1-associated protein 2) (BAI-associated protein 2) Length = 521 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 68 IYKKILH*FNPELPNLISMGE 130 +YK I+ FNP L N I+MG+ Sbjct: 16 VYKTIMEQFNPSLRNFIAMGK 36
>BAIP2_RAT (Q6GMN2) Brain-specific angiogenesis inhibitor 1-associated protein| 2 (BAI1-associated protein 2) (BAI-associated protein 2) (Insulin receptor substrate p53) (IRSp53) (Insulin receptor substrate protein of 53 kDa) (Insulin receptor tyrosine kin Length = 535 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 68 IYKKILH*FNPELPNLISMGE 130 +YK I+ FNP L N I+MG+ Sbjct: 16 VYKTIMEQFNPSLRNFIAMGK 36
>BAIP2_MOUSE (Q8BKX1) Brain-specific angiogenesis inhibitor 1-associated protein| 2 (BAI1-associated protein 2) (BAI-associated protein 2) (Insulin receptor substrate p53) (IRSp53) (Insulin receptor substrate protein of 53 kDa) (Insulin receptor tyrosine k Length = 535 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 68 IYKKILH*FNPELPNLISMGE 130 +YK I+ FNP L N I+MG+ Sbjct: 16 VYKTIMEQFNPSLRNFIAMGK 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,660,830 Number of Sequences: 219361 Number of extensions: 298337 Number of successful extensions: 1777 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
