| Clone Name | bastl42f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y537_MYCPN (P75241) Hypothetical protein MG360 homolog (G12_orf412) | 29 | 7.3 |
|---|
>Y537_MYCPN (P75241) Hypothetical protein MG360 homolog (G12_orf412)| Length = 412 Score = 28.9 bits (63), Expect = 7.3 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +3 Query: 198 LERTSPARSGTAVSAPQPLCPEAIRPSDHRR--RAFQLIIFCQTSAVYLLRASS----GG 359 L R+ +SG ++ LCP+AI + H R R + IF + + L + G Sbjct: 62 LARSYGIKSGMPIAKALELCPQAIFATSHFRNYRKYSAKIFAMIAEQFNLEVHTLSIDEG 121 Query: 360 FVVSASLPP*PIFSIGPK 413 FV L P FS+ + Sbjct: 122 FVCFRDLSPRKAFSLAKR 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,985,912 Number of Sequences: 219361 Number of extensions: 763917 Number of successful extensions: 2212 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2211 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)