| Clone Name | bastl42d07 |
|---|---|
| Clone Library Name | barley_pub |
>VG28_BPMU (Q9T1W6) Protein gp28| Length = 551 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 199 SLRPGREIQIRRFRGSERYSRVTSQSRHGLLQ 294 ++ P R+I + RF + + +T Q RHG++Q Sbjct: 298 AMTPARDIPVLRFEAPDDFESLTPQMRHGIVQ 329
>XERCL_PSEAE (Q9F771) Tyrosine recombinase xerC-like| Length = 427 Score = 29.3 bits (64), Expect = 4.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 328 KRSWSSANNRLRTLSAAAVETDVAVEGSSSPSGET 432 KRSW++ +N LRT+ A+E ++ +P +T Sbjct: 63 KRSWNTYSNHLRTIWGYAIEHELVTHSQVNPFRKT 97
>PCDA9_PANTR (Q5DRE3) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 28.5 bits (62), Expect = 7.2 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 289 LQPQTPFHLISMYKRSWSSANNR-LRTLSAAAVETDVAVEGSSSPS 423 L P PF L+S YK +S +R L S +A E V SPS Sbjct: 389 LTPHVPFKLVSTYKNYYSLVLDRALDRESVSAYELVVTARDGGSPS 434
>PCDA9_HUMAN (Q9Y5H5) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 28.5 bits (62), Expect = 7.2 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 289 LQPQTPFHLISMYKRSWSSANNR-LRTLSAAAVETDVAVEGSSSPS 423 L P PF L+S YK +S +R L S +A E V SPS Sbjct: 389 LTPHVPFKLVSTYKNYYSLVLDRALDRESVSAYELVVTARDGGSPS 434
>MRS3_YEAST (P10566) Mitochondrial RNA-splicing protein MRS3| Length = 314 Score = 28.5 bits (62), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 100 VLKESSFRYSSPEFSMTPVVHCSVGTIS 183 V+ ESS ++ +P P++HC G+IS Sbjct: 202 VIYESSTKFLNPSNEYNPLIHCLCGSIS 229
>MENF_PASMU (Q9CPI5) Menaquinone-specific isochorismate synthase (EC 5.4.4.2)| (Isochorismate mutase) Length = 431 Score = 28.5 bits (62), Expect = 7.2 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -2 Query: 321 ADQVEWCLWLQQPMARLR 268 ADQ EWC W++Q + +++ Sbjct: 160 ADQAEWCRWVEQGLQKIK 177
>DDL_MYCSM (Q9ZGN0) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 373 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 307 FHLISMYKRSWSSANNRLRTLSAAAVETDVA 399 F ISMY R W++ TL AA V+T +A Sbjct: 337 FTTISMYPRMWAAGGIDYPTLLAAMVDTAIA 367
>Y135_TREPA (O83171) Hypothetical protein TP0135| Length = 313 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 144 HDAGGSLLCWHHQPVPHRQPQARPRNTDKKVP 239 HDA G+ C + P PQ RP + +VP Sbjct: 194 HDAAGATSCAYAAPAATPTPQRRPAESVSRVP 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,017,615 Number of Sequences: 219361 Number of extensions: 978084 Number of successful extensions: 2381 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2378 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)