Clone Name | bastl42c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AMPN_HAEIN (P45274) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 30 | 4.6 | 2 | AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 30 | 4.6 |
---|
>AMPN_HAEIN (P45274) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 29.6 bits (65), Expect = 4.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 367 LPKEIFLKDYKKPDYLFDTVDLEFQLGDEKT 459 L K + KDYK+PD+ + L+FQL + T Sbjct: 2 LAKAKYRKDYKQPDFTVTDIYLDFQLDPKHT 32
>AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 370 PKEIFLKDYKKPDYLFDTVDLEFQLGDEKT 459 P+ + DY+ PDY +DL F L +KT Sbjct: 4 PQAKYRHDYRAPDYQITDIDLTFDLDAQKT 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,050,949 Number of Sequences: 219361 Number of extensions: 1172776 Number of successful extensions: 2519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2519 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)