Clone Name | bastl42b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 41 | 0.001 | 2 | CAC1S_RABIT (P07293) Voltage-dependent L-type calcium channel al... | 30 | 2.2 | 3 | MA205_DROME (P23226) 205 kDa microtubule-associated protein | 30 | 2.9 | 4 | FTSZ_CAUCR (P52976) Cell division protein ftsZ | 29 | 6.4 |
---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 41.2 bits (95), Expect = 0.001 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = +2 Query: 356 ADDENPEDFIDPETPSGQKKSLAPQ 430 A +ENPEDF+DPETP G++K L+ Q Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQ 135
>CAC1S_RABIT (P07293) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) Length = 1873 Score = 30.4 bits (67), Expect = 2.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 Query: 99 APPGPCAGACLDVAEHGESRVSLTG 25 APP PC D E G+ R SLTG Sbjct: 1736 APPAPCQQPSTDPPERGQRRTSLTG 1760
>MA205_DROME (P23226) 205 kDa microtubule-associated protein| Length = 1185 Score = 30.0 bits (66), Expect = 2.9 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 89 PGGATTRTTRSLTMEKPVAQAPEKAAS 169 PG ++T TT SL P+ AP KAAS Sbjct: 1071 PGSSSTTTTSSLRKSSPLKAAPGKAAS 1097
>FTSZ_CAUCR (P52976) Cell division protein ftsZ| Length = 508 Score = 28.9 bits (63), Expect = 6.4 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 17 KP*PV-RDTLLSPCSA-TSKQAPAHGPGGATTRTTRSLTMEKPVAQAPEKA 163 +P PV R+ +P A TS+ AP P T R + E+PVA APE A Sbjct: 328 EPKPVSRNISAAPLIAETSRPAPQPEPARPTARYEAARPAERPVAFAPEPA 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,671,581 Number of Sequences: 219361 Number of extensions: 400101 Number of successful extensions: 1366 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1366 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)