| Clone Name | bastl41h08 |
|---|---|
| Clone Library Name | barley_pub |
>SMBP2_HUMAN (P38935) DNA-binding protein SMUBP-2 (EC 3.6.1.-) (ATP-dependent| helicase IGHMBP2) (Immunoglobulin mu-binding protein 2) (SMUBP-2) (Glial factor 1) (GF-1) Length = 993 Score = 35.4 bits (80), Expect = 0.034 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +3 Query: 210 KSSRGLSRWKNPCQLSTMKVCLMHQLPDLHG---RLKVYPSRIVERSTLMFLLSGVTAG 377 K + G++ CQL + + CL H LP++HG R + + + + R +++ SG G Sbjct: 901 KCTAGVTTLGQFCQLCSRRYCLSHHLPEIHGCGERARAHARQRISREGVLYAGSGTKNG 959
>BBS5_BRARE (Q7ZWB7) Bardet-Biedl syndrome 5 protein homolog| Length = 342 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +2 Query: 203 EVEVFEGPQPMEE---SMPAVDNESLPDASTSRFTWKIESISKQNCRK 337 E E+ E PQP+EE P D E PD T FT +KQ+ R+ Sbjct: 267 EYEMEEKPQPLEELTVEQPPDDVEIEPDEHTDAFTAYFADGNKQHDRE 314
>SMBP2_MESAU (Q60560) DNA-binding protein SMUBP-2 (EC 3.6.1.-) (ATP-dependent| helicase IGHMBP2) (Immunoglobulin mu-binding protein 2) (SMUBP-2) (Insulin II gene enhancer-binding protein) (RIPE3B-binding complex 3B2 p110 subunit) (RIP-1) Length = 989 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +3 Query: 246 CQLSTMKVCLMHQLPDLHG---RLKVYPSRIVERSTLMFLLSG 365 C + + CL H LP++HG + + + +++ R +++ SG Sbjct: 907 CMHCSRRYCLSHHLPEIHGCGEKARAHARQMISREGVLYAGSG 949
>NAGS_HUMAN (Q8N159) N-acetylglutamate synthase, mitochondrial precursor (EC| 2.3.1.1) (Amino-acid acetyltransferase) [Contains: N-acetylglutamate synthase long form; N-acetylglutamate synthase short form; N-acetylglutamate synthase conserved domain form] Length = 534 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 368 NPRQQKHQSGSFYNSAWIYF 309 NP KH GSF N WI+F Sbjct: 482 NPWYFKHSDGSFSNKQWIFF 501
>NAGS_MOUSE (Q8R4H7) N-acetylglutamate synthase, mitochondrial precursor (EC| 2.3.1.1) (Amino-acid acetyltransferase) [Contains: N-acetylglutamate synthase long form; N-acetylglutamate synthase short form; N-acetylglutamate synthase conserved domain form] Length = 527 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 368 NPRQQKHQSGSFYNSAWIYF 309 NP KH GSF N WI+F Sbjct: 475 NPWYFKHSDGSFSNKQWIFF 494
>ADAM8_HUMAN (P78325) ADAM 8 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 8) (Cell surface antigen MS2) (CD156a antigen) (CD156) Length = 824 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 1 PAFSPPASPLNPSTRAANP 57 P F+PP P+ P AANP Sbjct: 777 PTFAPPVPPVKPGAGAANP 795
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 12 PPRLSPKP*HASSESPYAPRRSSTQPSP 95 PP+ PKP A + SP P+ QP P Sbjct: 29 PPKPQPKPPPAPTPSPCPPQPPKPQPKP 56 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 12 PPRLSPKP*HASSESPYAPRRSSTQPSP 95 PP+ PKP A + SP P+ QP P Sbjct: 9 PPKPQPKPPPAPTPSPCPPQPPKPQPKP 36
>LOXL1_MOUSE (P97873) Lysyl oxidase homolog 1 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 1) (Lysyl oxidase 2) Length = 607 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 6 FLPPR-LSPKP*HASSESPYAPRRSSTQPS 92 ++PPR + P+P E PY P RSS PS Sbjct: 345 YVPPRAVEPQPPFRVLEPPYLPVRSSDAPS 374
>LOXL1_BOVIN (Q95L39) Lysyl oxidase homolog 1 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 1) Length = 591 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 6 FLPPRL-SPKP*HASSESPYAPRRSSTQPSP 95 + PPR+ P+P E PY P RSS P P Sbjct: 329 YSPPRVVEPQPPFRVLEPPYLPVRSSDAPPP 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,518,208 Number of Sequences: 219361 Number of extensions: 586585 Number of successful extensions: 2002 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2001 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)