Clone Name | bastl41g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 38 | 0.006 | 2 | ACSA2_PSEPK (Q88DW6) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1)... | 28 | 6.7 | 3 | METB_HERAU (P24601) Probable cystathionine gamma-synthase (EC 2.... | 28 | 8.7 |
---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 141 MLTATKPLVGGACAAPS 191 MLTATKPLVGGACAAPS Sbjct: 1 MLTATKPLVGGACAAPS 17
>ACSA2_PSEPK (Q88DW6) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA| ligase 2) (Acyl-activating enzyme 2) Length = 644 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 108 TRWGGRLHRLGWFRPS*TVQPCPGRSGKEEVMEGS 4 T W + RL W +P +VQ C +GK +G+ Sbjct: 37 TFWAEQAKRLDWIKPWSSVQQCDLHTGKARWFDGA 71
>METB_HERAU (P24601) Probable cystathionine gamma-synthase (EC 2.5.1.48) (CGS)| (O-succinylhomoserine (thiol)-lyase) (Fragment) Length = 319 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 170 PD*RLGRRQHRGYATVLAIALRDGAEGCTVLV 75 P L R Q RG+ +++I L+ GAE +V Sbjct: 283 PQHNLAREQMRGFGGMISILLKGGAEAANAMV 314 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,656,689 Number of Sequences: 219361 Number of extensions: 562758 Number of successful extensions: 1262 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)