| Clone Name | bastl41g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 41 | 9e-04 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 40 | 0.001 | 3 | SURE_HALSA (Q9HQB2) 5'-nucleotidase surE (EC 3.1.3.5) (Nucleosid... | 28 | 7.8 | 4 | RS5_RHOS4 (Q3J5Q5) 30S ribosomal protein S5 | 28 | 7.8 |
|---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 40.8 bits (94), Expect = 9e-04 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = +1 Query: 193 MLPRKREIVAGEVEDLQKKXXXXXXXXXXXXXDA 294 MLPRKREIVAGEVEDLQKK DA Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEATREEGDA 34
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 193 MLPRKREIVAGEVEDLQKK 249 MLPRKREIVAGEVEDLQKK Sbjct: 1 MLPRKREIVAGEVEDLQKK 19
>SURE_HALSA (Q9HQB2) 5'-nucleotidase surE (EC 3.1.3.5) (Nucleoside| 5'-monophosphate phosphohydrolase) Length = 258 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 34 SPASFPDATGESKVSRRSHALDLT 105 +P DATGE V+R SHA D+T Sbjct: 172 APHPDADATGEMVVTRPSHAYDMT 195
>RS5_RHOS4 (Q3J5Q5) 30S ribosomal protein S5| Length = 187 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = -2 Query: 186 RDAAEEPEDGRRRSEEQAVVDGRRELPRQIQRVRPPRNLGFACRVGEGSRRGTVRLG 16 R+ + D R R E D + R + V+ + GFA V G +RG V G Sbjct: 4 RENRRDRRDDRSREETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFG 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,783,371 Number of Sequences: 219361 Number of extensions: 412103 Number of successful extensions: 1489 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1489 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)