Clone Name | bastl41g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EGFL8_MOUSE (Q6GUQ1) EGF-like domain-containing protein 8 precur... | 29 | 2.6 | 2 | YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8 | 28 | 5.8 | 3 | EGFL8_RAT (Q6MG84) EGF-like domain-containing protein 8 precurso... | 28 | 7.5 | 4 | C71BL_ARATH (Q9LTM2) Cytochrome P450 71B21 (EC 1.14.-.-) | 27 | 9.8 |
---|
>EGFL8_MOUSE (Q6GUQ1) EGF-like domain-containing protein 8 precursor (Epidermal| growth factor-like protein 8) (Multiple EGF-like domain protein 8) Length = 293 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 132 EVRVQVARGCRWVKESGAWLSEKTPLVPSRLRSLQ 28 E+R ++ + +W K++GAW+ P+ P LR Q Sbjct: 218 ELRGRLEKLEQWAKQAGAWVRAVLPMPPEELRPEQ 252
>YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8| Length = 1470 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 6 FLRAPPFSGDFGVSRAPTASSPRA 77 F R PP S +SR PT SSP A Sbjct: 975 FFRTPPPSAKTSLSRRPTVSSPSA 998
>EGFL8_RAT (Q6MG84) EGF-like domain-containing protein 8 precursor (Epidermal| growth factor-like protein 8) (Multiple EGF-like domain protein 8) Length = 291 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 132 EVRVQVARGCRWVKESGAWLSEKTPLVPSRLRSLQ 28 E+R ++ R +W ++GAW+ P+ P LR Q Sbjct: 216 ELRGRLERLEQWATQAGAWVRAVLPVAPEDLRPEQ 250
>C71BL_ARATH (Q9LTM2) Cytochrome P450 71B21 (EC 1.14.-.-)| Length = 499 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 62 VFSESQAPDSLTHRHPRATCTRTSVSAT 145 VFS +A + + H TCTR +SAT Sbjct: 74 VFSTKEAAEEVLKTHDLETCTRPKLSAT 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,450,542 Number of Sequences: 219361 Number of extensions: 449802 Number of successful extensions: 1504 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)