Clone Name | bastl41f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYGA_HELPY (P56453) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 29 | 2.5 | 2 | SYGA_HELPJ (Q9ZKP1) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 29 | 2.5 | 3 | SRS2_YEAST (P12954) ATP-dependent DNA helicase SRS2 (EC 3.6.1.-) | 28 | 7.2 |
---|
>SYGA_HELPY (P56453) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 303 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 229 FDFDHKRDAYGFAVRPQHLQRFREYAK----IYKEEEDERTHRWKDFL 360 F+ R A A R ++ + R+ AK +YKE+E+ER R K+ L Sbjct: 248 FNILDARKAISVAERQNYILQIRDLAKGCALLYKEQEEEREERLKNAL 295
>SYGA_HELPJ (Q9ZKP1) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 298 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 229 FDFDHKRDAYGFAVRPQHLQRFREYAK----IYKEEEDERTHRWKDFL 360 F+ R A A R ++ + R+ AK +YKE+E+ER R K+ L Sbjct: 248 FNILDARKAISVAERQNYILQIRDLAKGCAVLYKEQEEEREERLKNAL 295
>SRS2_YEAST (P12954) ATP-dependent DNA helicase SRS2 (EC 3.6.1.-)| Length = 1174 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 74 TRILNDEDFVNEERRGIFVVQ 12 TR+L+ ED ++EERR FV Q Sbjct: 702 TRVLSVEDSIDEERRMFFVAQ 722 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,672,672 Number of Sequences: 219361 Number of extensions: 443303 Number of successful extensions: 1082 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)