Clone Name | bastl41d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 40 | 0.002 | 2 | COG1_HUMAN (Q8WTW3) Conserved oligomeric Golgi complex component 1 | 40 | 0.002 | 3 | TRHY_RABIT (P37709) Trichohyalin | 28 | 8.3 |
---|
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 39.7 bits (91), Expect = 0.002 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +2 Query: 74 LFRTKRVAEIREVEAATRREISAKEEELRQLVGRSYR 184 LF T EIR +E R EI K+EELRQ+VG YR Sbjct: 21 LFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYR 57
>COG1_HUMAN (Q8WTW3) Conserved oligomeric Golgi complex component 1| Length = 980 Score = 39.7 bits (91), Expect = 0.002 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +2 Query: 74 LFRTKRVAEIREVEAATRREISAKEEELRQLVGRSYR 184 LF T EIR +E R EI K+EELRQ+VG YR Sbjct: 21 LFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYR 57
>TRHY_RABIT (P37709) Trichohyalin| Length = 1407 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 Query: 68 EELFRTKRVAEIREVEAATRREISAKEEELRQLVGRSYR 184 E L R +R ++RE E RRE E+ELRQ R +R Sbjct: 971 ERLRRQERARKLREEEQLLRRE----EQELRQERDRKFR 1005 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,405,628 Number of Sequences: 219361 Number of extensions: 36631 Number of successful extensions: 321 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)