| Clone Name | bastl41d07 |
|---|---|
| Clone Library Name | barley_pub |
>C4BP_RAT (Q63514) C4b-binding protein alpha chain precursor (C4bp)| Length = 558 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 128 PVAICSFETCTNIPTNHPSQVTTHPRKRSSE 220 PV +C +CT+IP + + T PR R + Sbjct: 254 PVPVCELNSCTDIPDIPNAALITSPRPRKED 284
>CNG15_ARATH (Q9SL29) Putative cyclic nucleotide-gated ion channel 15 (Cyclic| nucleotide-and calmodulin-regulated ion channel 15) Length = 678 Score = 28.1 bits (61), Expect = 5.8 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +3 Query: 39 RTGASCSIQAA--THRRRKAEHPVGA--EFSFLFRSLSVRL 149 RT A+C IQAA HR+RK + + A EF + F + + RL Sbjct: 607 RTWAACFIQAAWRRHRKRKYKTELRAKEEFHYRFEAATARL 647
>XRN1_SCHPO (P40383) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Exonuclease 2)| (Exonuclease II) (Exo II) (p140) Length = 1328 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 40 GQEHRVPSKLRRTDDEKQSIPSEQSFLFFSGRYLFV 147 G E R PS + +D K ++ SEQ + + G+ +FV Sbjct: 743 GNESRNPSVIVNVEDVKSALTSEQIAMQYVGKRIFV 778
>RECR_RHOPA (Q6NC55) Recombination protein recR| Length = 200 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 131 VAICSFETCTNIPTNHPSQVTTHPRKRSS 217 + +CS TC NI + +P V T PR+ SS Sbjct: 56 IEVCS--TCGNIDSQNPCTVCTDPRRDSS 82
>CCD93_CHICK (Q5ZKI4) Coiled-coil domain-containing protein 93| Length = 617 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 40 GQEHRVPSKLRRTDDEKQSI 99 GQEHR P ++ +DE+Q+I Sbjct: 6 GQEHRAPQEVETREDEEQNI 25
>DML2_ARATH (Q9SR66) DEMETER-like protein 2| Length = 1309 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 75 HRRRKAEHPVGAEFS---FLFRSLSVRLKLAQTSRPIIPHKSQPTPE 206 H RR PV F FL++ + +Q PII + P PE Sbjct: 991 HERRSKRKPVVVNFRPSLFLYQEKEQEAQRSQNCEPIIEEPASPEPE 1037
>BTHD_DROME (Q9VYB0) Selenoprotein BthD precursor (dSelM)| Length = 249 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 172 GRDVCASFKRTDSDRKRKENSAPTGCSAFRR 80 G + AS K+++S + +EN APT S R+ Sbjct: 141 GSEAIASPKKSESTEEAQENKAPTSTSTSRK 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,892,929 Number of Sequences: 219361 Number of extensions: 655519 Number of successful extensions: 1821 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1821 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)