Clone Name | bastl41d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 59 | 5e-11 |
---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 58.9 bits (141), Expect(2) = 5e-11 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 350 ADDENPEDFIDPETPSGQKKSLAPXMAKQYSPSTVE 457 A +ENPEDF+DPETP G++K L+ MAKQYSP+TVE Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPATVE 146 Score = 26.9 bits (58), Expect(2) = 5e-11 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 457 KSWYAWWE 480 KSWYAWWE Sbjct: 147 KSWYAWWE 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,692,430 Number of Sequences: 219361 Number of extensions: 399473 Number of successful extensions: 1189 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1189 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)