Clone Name | bastl41b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YGY5_YEAST (P53071) Hypothetical 19.3 kDa protein in HAP2-ADE5,6... | 29 | 2.3 | 2 | EXON_HHV2 (P06489) Alkaline exonuclease (EC 3.1.11.-) | 28 | 6.8 | 3 | DNBI_BFDV (P13893) DNA-binding protein (Agnoprotein) | 28 | 6.8 |
---|
>YGY5_YEAST (P53071) Hypothetical 19.3 kDa protein in HAP2-ADE5,6 intergenic| region Length = 178 Score = 29.3 bits (64), Expect = 2.3 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = +3 Query: 258 VYSIGHPATAGKQCLLSILHSTTTMTMMIPHYPSRG-----RQPAGQPP 389 ++++G P TAG L SIL+ T ++ +P PSR R P PP Sbjct: 45 IWALG-PHTAGPLLLFSILNCTPARSVTLPISPSRASISFTRMPLPTPP 92
>EXON_HHV2 (P06489) Alkaline exonuclease (EC 3.1.11.-)| Length = 620 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 258 PIQPHLVACPARRPAGAERG 199 P+QPHLV R AGAE G Sbjct: 508 PLQPHLVTFLGRHRAGAEEG 527
>DNBI_BFDV (P13893) DNA-binding protein (Agnoprotein)| Length = 61 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 8/37 (21%) Frame = +3 Query: 291 KQCLLSILHSTTTMTMMIPH--------YPSRGRQPA 377 +Q LLS+LHS T + +++P PS RQPA Sbjct: 7 RQALLSLLHSLTRLPLLLPPLRLLLLLLLPSPPRQPA 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,813,836 Number of Sequences: 219361 Number of extensions: 484048 Number of successful extensions: 1027 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)