Clone Name | bastl40h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LACI_KLEPN (P06220) Lactose operon repressor (Fragment) | 28 | 5.4 | 2 | YP79_CAEEL (Q09439) Hypothetical protein B0228.9 | 27 | 9.2 | 3 | SGTB_MOUSE (Q8VD33) Small glutamine-rich tetratricopeptide repea... | 27 | 9.2 | 4 | SGTB_HUMAN (Q96EQ0) Small glutamine-rich tetratricopeptide repea... | 27 | 9.2 |
---|
>LACI_KLEPN (P06220) Lactose operon repressor (Fragment)| Length = 354 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 235 AARVSIPAAVRRTIQNIKEIAGNHTDEEVYAALRECDMDPNETAQKL 375 A R +PA R + N E+ T E+V A++ PN +AQ L Sbjct: 12 ARRGRVPADGLRRVLNRPEVVSARTREQVIRAMQALHYVPNRSAQLL 58
>YP79_CAEEL (Q09439) Hypothetical protein B0228.9| Length = 338 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 250 IPAAVRRTIQNIKEIAGNHTDEEVYAALRECDMDPNE 360 +P V +T+QN +E TD+ + E MD NE Sbjct: 153 LPDGVDQTLQNFEEFGDWITDDAIIVVCDEQKMDKNE 189
>SGTB_MOUSE (Q8VD33) Small glutamine-rich tetratricopeptide repeat-containing| protein B Length = 304 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +1 Query: 247 SIPAAVRRTIQNIKEIAGNHTDEEVYAALREC-----DMDPN 357 S+P V + Q +K+ NH EE YAA +C ++DPN Sbjct: 77 SVPEDVGKADQ-LKDEGNNHMKEENYAAAVDCYTQAIELDPN 117
>SGTB_HUMAN (Q96EQ0) Small glutamine-rich tetratricopeptide repeat-containing| protein B (Small glutamine-rich protein with tetratricopeptide repeats 2) Length = 304 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +1 Query: 247 SIPAAVRRTIQNIKEIAGNHTDEEVYAALREC-----DMDPN 357 S+P V + Q +K+ NH EE YAA +C ++DPN Sbjct: 77 SVPEDVGKADQ-LKDEGNNHMKEENYAAAVDCYTQAIELDPN 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,637,452 Number of Sequences: 219361 Number of extensions: 112703 Number of successful extensions: 609 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)