Clone Name | bastl40g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RL15_LACPL (Q88XW7) 50S ribosomal protein L15 | 30 | 2.3 | 2 | ARX1_ASHGO (Q74ZU6) Probable metalloprotease ARX1 (EC 3.-.-.-) (... | 29 | 3.9 | 3 | ACES_CHICK (P36196) Acetylcholinesterase precursor (EC 3.1.1.7) ... | 28 | 5.0 | 4 | ARX1_CANGA (Q6FL44) Probable metalloprotease ARX1 (EC 3.-.-.-) (... | 28 | 6.6 |
---|
>RL15_LACPL (Q88XW7) 50S ribosomal protein L15| Length = 143 Score = 29.6 bits (65), Expect = 2.3 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 71 TPSPGSRIGRRRLFAAGQSQGAIMASNTGASGW-LRGKVK 187 TPS GSR RRR+ G S G S G G RGKV+ Sbjct: 7 TPSEGSRFSRRRI-GRGDSSGQGKTSGRGQKGQKARGKVR 45
>ARX1_ASHGO (Q74ZU6) Probable metalloprotease ARX1 (EC 3.-.-.-) (Associated| with ribosomal export complex protein 1) Length = 591 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 80 PGSRIGRRRLFAAGQSQGAIMASNTGASGWLRGKVKA 190 PGSR+ R R F AGQ++G + + W +A Sbjct: 246 PGSRVRRVRRFLAGQNEGVVAERDIKGVHWTEAHQEA 282
>ACES_CHICK (P36196) Acetylcholinesterase precursor (EC 3.1.1.7) (AChE)| Length = 767 Score = 28.5 bits (62), Expect = 5.0 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 59 PAGQTPSPGSRIGRRRLFAAGQSQGAIMASNTGASGWLRGKVKA 190 P G + G+ GRRR A G++ G + T G LRGK A Sbjct: 256 PNGPWATIGAAEGRRRAAALGRAVGCPYGNETEFLGCLRGKEAA 299
>ARX1_CANGA (Q6FL44) Probable metalloprotease ARX1 (EC 3.-.-.-) (Associated| with ribosomal export complex protein 1) Length = 588 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 80 PGSRIGRRRLFAAGQSQGAIMASNTGASGWLRGKVKA 190 PGSR+ R R F AGQ++G + + W +A Sbjct: 241 PGSRVRRIRRFLAGQNEGIVAEKDYKGVVWTEAHQEA 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,627,252 Number of Sequences: 219361 Number of extensions: 473119 Number of successful extensions: 1804 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1804 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)